ZNF582-AS1

From LncRNAWiki
Revision as of 05:41, 23 June 2016 by Chunlei Yu (talk | contribs) (Created page with "==Annotated Information== ===Approved Symbol=== ZNF582-AS1 ===Approved Name=== ZNF582 antisense RNA 1 (head to head) ===Previous Symbols=== _ ===Synonyms=== _ ===Chromosome===...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search

Annotated Information

Approved Symbol

ZNF582-AS1

Approved Name

ZNF582 antisense RNA 1 (head to head)

Previous Symbols

_

Synonyms

_

Chromosome

19q13.43

RefSeq ID

NR_037159

OMIM ID

_

Ensembl ID

ENSG00000267454

pubmed IDs

12477932

Sequence

>gi|311771648|ref|NR_037159.1| Homo sapiens ZNF582 antisense RNA 1 (head to head) (ZNF582-AS1), transcript variant 1, long non-coding RNA

000001 GGTGAGCCGG ACGCAGGCGT GCCTGCGCAG TGCGCGGAGG AGTGCTGTTC GTGTGTTCGA GTCCCTGGGT TGCTTCCTGG 000080
000081 GGTCTGTGGT GCTGGGTGTG CTATCTGCGT GTGATTCTCT AGCGAGAGAT TGTGGGCGAG TGACCGAGTG GGCAAGGGGC 000160
000161 CGTCACTGTG TGTGCGTGAT TTTGACAGTG TGTGGTGGTA GCTTCTGACT CCGCGTGGGT CGTTGAATGT ATGACTGGGA 000240
000241 CCGTTTAGCG GTGGATACAC AACTGTGTGC GGCTGTGGAA GATTGCCTCA TCCGTTACGT TCCCATTTCC GTGGAACAAC 000320
000321 AGTTTTACCA GAAGGTTTCG AAGGAACCTT AAAGTTTGGA AGCGTAAGAG TTTATCTGGC GGCTTTGGTG TCATCAAATG 000400
000401 TGAGAAGCCC TGGACTTTAC ACATCCCGAG CCAGTGTGAT CCAGTATGAT TGGGAGTCCG AGTGCCAGAT GCCGGTCAGG 000480
000481 ACCTGTTATG CTGGGTCTCA GAATGCGGAA ACTCTCCCTG TCCGAGGTGG AACAGTTTGT CCTTGAGTGA GGACTGGAGT 000560
000561 CCTGAGTGAC TCTTTTGATT TGATCCTGTT TCCCTCAAAC CTGAGATGGG AGCCTCACTG TATTGCCCAG GCTGGTCTTG 000640
000641 AACTCCGGAG CTCAAGTGAT CGTCTTGCTT CAGCCTTGCA AAATGATGGT GAAGCTGCAT CATTGTCTGG GGTAAATACC 000720
000721 TGAGGTTCGT TGTCTCACGC CAAGGGAATC AAGGACGTGG ACACACAAGA AATGGAGTCC CTGTCTGACC GGGCCATGTT 000800
000801 GTATGTTCCT TGCTGTACAC GTGGTTGACA AAGAAAAGGG AAGATGGAGC TGCGATGTTG GACATGCCTG GCCCCCAGGT 000880
000881 AGCTTTTTCC TATTGGCACA GCTGCTGGCA TTCACCCGTG CAAACTTCCA GCTTGCTTAT CTATGTCTGC AGCTTGATTT 000960
000961 TTCAGGCTGC TGTTTGTTAG AAAAGAAATG ACTTGGGGGC TGCTTTTCAT TAAAAGGAAA ACCTTACCGG GGATTTCCTT 001040
001041 ACCCTCACTA TCTGCCTAAA TAATTTCTTT TTAACTCCTA TGTCACTTGG GATTACAGGC ATGAGCCGCT GTGCCTGCTA 001120
001121 GAGGGTTTTT TATCTTTATT CCTCAAGATT TTGCATTTAG ATAATTATGT TAAACTTGGG TGTGCTAGGT AGACATACGT 001200
001201 CTGCTGATTA CCTGTTTAGG AAGAATGTGG ATTCGTACGT AGGGAAAAGG AGTCAGGCTG GTGGGACCAG GGGAAAGCAA 001280
001281 AGAGATAAAG CAAATAAGCT ATAGATCTGC ATTTTCTTCA TGGTCCAGGA TATATAAACA AAAAAAGGAA GCAGATAAGC 001360
001361 TATAGGCTTG CTTTTCTTTA TGACCCAGGA CATACAGCCC TGCCGAGCAA ATAATGAACG TAACTCACAA ACTTCCTGCT 001440
001441 TATCATCAAA CGCACGCATC CACTTATCAT CAAACACCTC GGGTGACAGA AGAATGCAGG TCAGCTCCCT GCTGCCTTGG 001520
001521 CATTATCAAT CAGCCCAGGA ACCATCCTAT AAAATCTCCA GCAAGCCTTT GTTTCCTTGC AGTCAGCTCC TCTTCCACTG 001600
001601 ATTCTGCCTG TTGCTCCCTG ATAACATACT TTGATACTGT CTTTAATAAA TCTGCCTTTC TTCACAAAAA AAAAAAAAAA 001680
001681 AAAAAAAAAA A

Predicted Small Protein

Name ZNF582-AS1_smProtein_1379:1600
Length 73
Molecular weight 8310.213
Aromaticity 0.0684931506849
Instability index 67.4301369863
Isoelectric point 9.05621337891
Runs 12
Runs residual 0.0202386212992
Runs probability 0.0362568450804
Amino acid sequence MTQDIQPCRANNERNSQTSCLSSNARIHLSSNTSGDRRMQVSSLLPWHYQSAQEPSYKIS
SKPLFPCSQLLFH
Secondary structure LLLLLLLLLLLLLLLLLEEELLLLLEEEELLLLLLLEEEEHHHLLLHHHHLLLLLLEEEL
LLLLLLLLLLLLL
PRMN -
PiMo -