ZNF667-AS1

From LncRNAWiki
Jump to: navigation, search

Annotated Information

Name

Approved Symbol: ZNF667-AS1

Approved Name: ZNF667 antisense RNA 1 (head to head)

Synonyms: MORT

Ensembl ID: ENSG00000166770

RefSeq ID: NR_036521

LncBook transcript ID: HSALNT0289293

Chromosome

19q13.43

Characteristics

-

Function

  • MORT might play a tumor suppressor role in cancers [1].

Regulation

-

Disease

Cancers [2] [1].

Expression

ZNF667-AS1 is expressed in all normal cell types, but epigenetically silenced during cancer-associated immortalization of human mammary epithelial cells[1].

pubmed IDs

26646903, 29707199

Sequence

>gi|302488598|ref|NR_036521.1| Homo sapiens ZNF667 antisense RNA 1 (head to head) (ZNF667-AS1), transcript variant 1, long non-coding RNA

000001 AGAATCCACC GGGGTGCAGC GAGGCTGTGG AAAGTCCCAC CCAGAACGTG AGGTGAAGAA GGCTTGGGCT GCGCTGGTTC 000080
000081 TGCTCTGTCC GGGTCGGAGA TGAACTGACC CGGGAGAGCA GCGGAGGGAT GTTTCTTTTG GCCAACAGTG GGGACTCACC 000160
000161 TGCACGTTTT GCGAAGAGGC CCACAGTCCT TTGCGTGGCG CTCGGACTAC ATTTCCCAAC GGCCCCTGCA CGCCCTGGGG 000240
000241 GCTGTTCCAT GCGGTGTTGC GCCTGCGTAG CCGGCGGGCT GGCAGTGAGA CTGACTGCGT CGGGGTTGAG ACTGGGTGGA 000320
000321 TGAGGCTCAC CCCGGCGGGG AGAAGGGACG AGGAGGGGCG GACAGCGGAA GGTCCGGGAG TGTCCGCCAT AAAGTCGTTT 000400
000401 GAGGTGACCG TTGCGTAATT GTGAGTCTGT GAGAGAAGAT GTGAAGTATG GCCTCGTCCC GGTCATCTGG GCGTGCGGGT 000480
000481 CCCGGGTTTT GATCGCGCGT TTGTGTAGTT TTAACTTCTA GTCATGGCGA ATGATCGCAG GAGAGCACAG ACTGGACCCT 000560
000561 GCTACGATCT CTCTTGGAGT GGATCAGACT GATGATCACC AACAACCAAC TCATTCCCGG ATAAGGAAGA AGAGAGTGTC 000640
000641 ACCTACTTCA GTGTGGTTTC AACCCTACTT CTGCATCTTA AAGACACTGT ATGGTTTCAG CAGTAGTGCC CCTGTTCATT 000720
000721 AGTCCCCCTG ATGTTTTCAT TCCTCATCTC ATCTTTTTCT TAGCAGCATT CAATGAATCC TTCATTCTAG AAACACTCTA 000800
000801 TATCTTTGGT TTTCATGAGA CCATTCTCAC CTTGTTTTGT CCTGTGACTT TTTTGAAAAA AACAAAAACA AAAAACCCTT 000880
000881 TTTTTCTTTT TAAATTCTGG TAAAAAACAC AATGAAAATT TGCTATCTTA ACCATGTTGA AATGTGCAGT TAGTAAAGTA 000960
000961 CATTCACATT GTGGTGCAAG CCATCACTAC CATCCATCAC TAGAACCCTT TTCATCTTGC AGATCTGAAA CTCTACCCAT 001040
001041 TAAACGACTT CCCATCTTCC CATCCCCACA GCTCCTAGCA ACCAACATTC TACTTTCTCT ATCAGTTTGA CTACTCTAGG 001120
001121 TACCTCATAT GAGTAGAATC ATACAGCATT TATCCTTCTC TGCCTGGCTT ATTTCACTTG TATAATGTCC TCAAGGTTCA 001200
001201 TTCATGTTGT AGCATGCATC AGAACTTCCT CCCCTTTTAA AGGCTGGATA ATATTTCATG GTATGTTTAG ATCACATTCT 001280
001281 GTTTATCCAT TCATCCATCA GTGAACACTT GTGCTCCTTC CAACTTTGGG CTGTTGGGTG TCCTGCCACT GTTGCTCCTA 001360
001361 GTGCTCAATC TCGTTTATTC CCTCCTAATC AAGTGTACAA CGTTGGACAC TGTGCAGGAT GATGCCACTT CATCTTGGAT 001440
001441 GCTAATCTGC CATGTTGACT TCTGATTAAC CCCAGGCCCA GGAATGCCTC AAGATTTCTA CTTTACTTAC TGTTGCTTGT 001520
001521 GTAAGCCAAG ACAACCTTGA TGTTATCATA AACATGTACT TACCTAAGTC CTGTCCTTTG GCAAATTATG GGCTATGAGA 001600
001601 CACAGCATTC TTGCCTTTCC CTGAGGGGTC AATTTCAGCG ATCCTACACA TTCCTTCTGA AGCACTTATG CTCTTTCTAT 001680
001681 ATGGTATGTA AGCTCTCGGT CTGGGGAGTA ACAGTGCAGA GATCTACCTG TCTTGTTGCC ACATGTTTCT AAACTTTCCA 001760
001761 ATAAATCACC TTCTACTGAC AAAAAAAAAA AAAAAAAAAA AAAAAAAAAA AAAAAAAAAA AAAAAAAAAA AAAAAAA

Labs working on this lncRNA

  • The University of Arizona Cancer Center, Tucson, AZ, 85724, USA

References

  1. 1.0 1.1 1.2 Vrba L, Futscher BW. Epigenetic silencing of lncRNA MORT in 16 TCGA cancer types. F1000Res. 2018 Feb 21;7:211.
  2. Vrba L, Garbe JC, Stampfer MR, Futscher BW. A lincRNA connected to cell mortality and epigenetically-silenced in most common human cancers. Epigenetics. 2015;10(11):1074-83.

Predicted Small Protein

Name ZNF667-AS1_smProtein_128:322
Length 64
Molecular weight 6445.639
Aromaticity 0.046875
Instability index 53.3734375
Isoelectric point 9.93939208984
Runs 11
Runs residual 0.02328125
Runs probability 0.0492685198569
Amino acid sequence MFLLANSGDSPARFAKRPTVLCVALGLHFPTAPARPGGCSMRCCACVAGGLAVRLTASGL
RLGG
Secondary structure LEEEELLLLLHHHHLLLLEEEEEELLLLLLLLLLLLLLLLLLHHHHHLLLLEEEEELLLL
LLLL
PRMN -
PiMo -

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[XeyU3nWWu5SI3U5oG10OHgAAAAA] 2019-12-08 06:14:59: Fatal exception of type "TypeError"

Navigation menu