PCAT29

From LncRNAWiki
Jump to: navigation, search

Annotated Information

Approved Symbol

PCAT29

Approved Name

prostate cancer associated transcript 29 (non-protein coding)

Disease

prostate cancer

Chromosome

15q23

RefSeq ID

NR_126437

OMIM ID

616273

Ensembl ID

ENSG00000259641

pubmed IDs

25030374

Sequence

>gi|703491616|ref|NR_126437.1| Homo sapiens prostate cancer associated transcript 29 (non-protein coding) (PCAT29), transcript variant 1, long non-coding RNA

000001 GTTATTATTA CCTGAGACCC TGAAAGGAAG CACTAAAGAA ATGAAGACAG AGGAATACCA GGAGAGAAAG GAGGTCCAGT 000080
000081 TAGACCTAAA GGTGGGCAAG AAGAAGAAGA AGAGAGTGCT TTGCCTGTAG CATTTGAGGC AGGCGGCTGG GACACTGAAT 000160
000161 GAAGAGCCTG GGGGAGGCAG GTTCAGCATG CCACCGTTTC CTGGTCATGA AGATGCCAGC TCCAGCTCCA AGCAGAGGAG 000240
000241 GCTGGCCTTT GCCCCACGGC CTTGGCTGCA GCACCATCAC ATGCCTCCAC GCCTCTCCAT CTCCTCATGA AGATCTCTCT 000320
000321 CCAGATAGAG ACCATTTCCT CCCTAGAGGA ATCCTTGTAC TATCCGTAGG AGGCACCTGT TGAATTCAGG CATCGGCATG 000400
000401 TGACTTGATT TGGTCAATGA AATGTGAGAG AAGTGACATC CACTTTGAGG CAGGCACTTT CCGAATGCCA TCAAGCTGAG 000480
000481 ATGTGAAGCG GAAGTGAGGC AGAGGCTCCC TTCCTTTTGT TTGGCGCAGT TTTCTGTGAG AGAGCAGAGG TGGGAGATGA 000560
000561 GGGGACCTCT GCCCCAGTGT TTCTGCATCC AAGCTCCAGC CTTGTTGAAG GTTGCCCCGA CGGCCACTCT CCATACTGCT 000640
000641 GCCAGAAGAA CCTTGAAATA TCGCTCTTTT TAATTAAAAA GCAAAACTCT TCAA

Predicted Small Protein

Name PCAT29_smProtein_158:382
Length 74
Molecular weight 7759.9512
Aromaticity 0.0405405405405
Instability index 71.9851351351
Isoelectric point 7.76202392578
Runs 10
Runs residual 0.00751483190508
Runs probability 0.0421568627452
Amino acid sequence MKSLGEAGSACHRFLVMKMPAPAPSRGGWPLPHGLGCSTITCLHASPSPHEDLSPDRDHF
LPRGILVLSVGGTC
Secondary structure LLLHHHLLHHHHHEEEEELLLLLLLLLLLLLLLLLLLLLEEEEELLLLLLLLLLLLLLLL
LLLLEEEEEELLLL
PRMN -
PiMo -