Lnc-DHX37-1:1

From LncRNAWiki
Jump to: navigation, search

THRIL, TNF and HNRNPL related immunoregulatory long non-coding RNA, which was 1981 bp in length and located in 12q24.31, functions in the regulation of innate immune signaling.

Annotated Information

Transcriptomic Nomeclature

THRIL: TNF and HNRNPL related immunoregulatory long non-coding RNA(HGNC nomenclature)

"BRI3BP antisense RNA 1", BRI3BP-AS1, Linc1992, TCONS_00020260, "TNFalpha and hnRNPL related immunoregulatory LincRNA"[1]

Function

Linc1992 bound specifically to heterogenous nuclear ribonucleoprotein L (hnRNPL) and formed a functional linc1992-hnRNPL complex that regulated transcription of the TNFα gene by binding to its promoter, which may play important roles in the innate immune response and inflammatory diseases in humans[1].

Diseases

  • Kawasaki disease, rheumatoid arthritis and inflammatory bowel disease[1]

Expression

Primers were as follows,

Experiments Primers Forward Sequences Reverse Sequences
qPCR Bri3bp 5'-CTGGGAGTGGATATGTTCGTG-3' 5'-CTGGGCTGAAATACTGGGAC-3'[1]
TNFalpha 5'-cagcctcttctccttcctgat-3' 5'-gccagagggctgattagaga-3'[1]
hnRNPL 5'-AATGGAGTTCAGGCGATGG-3' 5'-TCACCTTGTCCACTGAGATTG-3'[1]
GAPDH 5'-atggggaaggtgaaggtcg-3' 5'-ggggtcattgatggcaacaat-3'[1]
shRNA Designs Bri3p 5'-CCGGAAGGACCGAGCTCTTGGATGTCTCGAGACATCCAAGAGCTCGGTCCTTTTTTTG-3' 5'-AATTCAAAAAAAGGACCGAGCTCTTGGATGTCTCGAGACATCCAAGAGCTCGGTCCTT-3'[1]
5'-CCGGAAGCGTGTACATCCTGCACAACTCGAGTTGTGCAGGATGTACACGCTTTTTTTG-3' 5'-AATTCAAAAAAAGCGTGTACATCCTGCACAACTCGAGTTGTGCAGGATGTACACGCTT-3'[1]
5'-CCGGAAGCGCGGAGAAGAACAGCTACTCGAGTAGCTGTTCTTCTCCGCGCTTTTTTTG-3' 5'-AATTCAAAAAAAGCGCGGAGAAGAACAGCTACTCGAGTAGCTGTTCTTCTCCGCGCTT-3'[1]

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

  • Program for RNA Biology, Sanford-Burnham Medical Research Institute, La Jolla, CA 92037.[1]

References

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 Li Z, Chao TC, Chang KY, Lin N, Patil VS, Shimizu C, et al. The long noncoding RNA THRIL regulates TNFalpha expression through its interaction with hnRNPL[J]. Proceedings of the National Academy of Sciences of the United States of America. 2014,111(3):1002-7.

Basic Information

Transcript ID

lnc-DHX37-1:1

Source

LNCipedia2.1

Same with

NONHSAT031707, THRIL

Classification

intergenic

Length

2893 nt

Genomic location

chr12-:125510478..125513897

Exon number

2

Exons

125510478..125511964,125512492..125513897

Genome context

Sequence
000001 GGTAGAGACG GGATTTCACT ATGTTGGCCA GGCTGGTCTC GAACTCCCGA CCGCAAGTGA TCCACCCGCC TTGGCCTCCC 000080
000081 AAAGTGCTGG GATTACAAGC TTGAGCCACT GCACCCAGCC TGGAAAGTAT ATTTATGAAA GGTTTGCACT CCACAAAAGC 000160
000161 ATCTTTGCTA GGGTGTCAAG GAAGAGATCA CTAAACCAAC CCCAACACAT CCATACAATT CCAGCAATCT AGAGAGGGCT 000240
000241 GGTCCTTTTC CTTTTCTGGA TTATTTTCTG TTCTCAGTAA AACAAGTATT TACTGTGATA CTGAAACACT GGGAAATTAA 000320
000321 CACTGATTAA GATATTTTAA ACACTGAGTC TTAATTATAA CAGAACCAGT TTTCATCAGA ATGCTTTTAC GTCACATTCA 000400
000401 GTGAAGTGTT ACGCTAATAT ATTCTACAGC CCTGAAGATA GAAAAAAGGT TTCTCTCCAG GTATGAGATA TGGTACAAAA 000480
000481 ATACATTTTT CCACATACAA AAGAGAGAAA AAAACAAAGA CATGTGGCGG GTGGCGAGGG GAGGCCCAAT CCCAACACCC 000560
000561 TACAAGGTTC CATGGAATGG AGAAGGAACA AAAAAATCCC CAATTATTTT GGGGTAAGAT GTGCCCCAGA AAAGGTGAAA 000640
000641 TCTATGCAAT AAAACCCAGG TTTTCTTCAA ATCTAGCATC TAGGATTTCT ATCAGAGTTT CAAATAATCA GAATTTCTAT 000720
000721 CAGAATTTCT ACCCTGAGGT GACACCTACT AACTGTAGGT TCTTTCATTA AAAATGAAGA CATCTTTCAC CAGAATGTAT 000800
000801 CAAGCTATAA AACTGGCTTC AGAGCCTACA CTTAGCCAGA GTGGAAAAAA AAAATAGTGC ATATTTTCGA CAGCAATTTT 000880
000881 GAATTGATGC TTGAGGTCTC AATCCACCAG CACCCAGATA TCATGTTACC TCCCTCAGTT GAATACAAGT TAAAATGATG 000960
000961 ATCTTATCGA GATCTCAATA GAGCACAGTG CCCTTCATGT TTCGGGTAAG AGGGTGGGAG GAGGAATGAA GCGGGTATTA 001040
001041 CACCCAGCCC AGTGACAGCT TAAGCCTTAA CATGCGGGCA TCTTACAATG ACCATAAACA AGGGAGGGGC CAAGGCAGGG 001120
001121 CTGGCGATCA TTAGCTTTGC GCACAGAATG CCATGTTTTC CCCTGGCCAA CATAAGCAAA GCTGTTTTAG TACCTAAACG 001200
001201 TGGTATAGCC AAATGCACAA AAGGAAAGAA GATAGAGATG ACCTCCCGAG TTATTTATAC CTTGTGCTAA AATAGATTCA 001280
001281 TCTACAAGTA TCTAAATGAC AAAACTAGAA TGATTTCAAC CCAGTAATCC TGTGTTCCAA TGTGCATGGA TAAAGATTTG 001360
001361 ATCTAGGCCC AGCGCGGTGG CTCACGCCTG TAATCCCAGC ACTTTGGGAT TATAGGGGTG AGCCACCCTG CCCAGCCTGC 001440
001441 TCCAGCAAAT CTTAAATATC CATGCACACT GAATAAACAT GCACCTGAAA CAGGTGCACG TTTCAGGAAG TGAATGGAAC 001520
001521 TCTCCAGGAG AGTTTGGGTC CCATCATGTG TACCTTAGAA ACAGAAGTCT CAAAAGTCTC AACAACATCC ACAAAAACAT 001600
001601 CTGCATCTGT TTTCCAGATA CTTGCAACCA AAAATAAAAC TTCACAGGAA CACTACACAA GAAGTGGTAG ACAGCTAAAT 001680
001681 CTTCTCCAAA CTGAGACCTG GACCATAAGG TCTTGGTTGT AGCAGGTCTG GCAGGGGTTA TCTATAAACC TGCACGCAGG 001760
001761 GCACTGTGAG CGGGTTGCCA GGGTACATCT GTGGCCAGGT AAGGGCCACA GAGACAGTCG TGATCCCCAG CAGCTTCAAA 001840
001841 GCTGCAAAAT GCTGGGCTTT TTTTTTTTTT TTTAAGATGA AGTCTTGCTC TGTTGCCTAG GCTGGAGTGC AGTGGCGTGA 001920
001921 TCTCGGCTCA CCGCAACCTC CACCTCCCAG GTTCAAGCAA TTCTCCTGCC TCAGCCTCCT GAGTAGCTGG ACTACAGGCA 002000
002001 CCCACCACCA TGCCTGACTA ATTTTTGTAT TTTTAGTAGA GACGGGGGTT TCACCATGTT GGCCAGGCTG GTCTTGAACT 002080
002081 CCTGACCTCA GGTGATCCAT ACTCCTCGGC CTCCCAAAGC GCTGGGATTA CAGGCATCAG CCACTGCGCC TGGCCTAGGG 002160
002161 CTTTCTTTTT TAAAAAACAA GTCCTAACAA AAGGGGGTTT CTACCAGCCC CTGAGCCACA CCTTCTGAAA CTCCCTTGCC 002240
002241 CAGGATCCCC ACAGCTGTCC ACCTCGCAAG TCCCACTCTC TGCCCACAGA GACTGCCTAA AAGGAGGACA CAACAGATTT 002320
002321 CAGATAAAAA GCACCTGTGT ATCGTAAATA TTTCAGGAAA AAGAATTCAG ATCTTTTCAA AGGCTTGCTT ATTGCTGCTA 002400
002401 ATTGTTCCTG AGGATCTTTC TAAGCAGCAA TATACTTGAG AATATTAGCT GCTACTGTTT GTTTTCCCTC TAAGGTCCTG 002480
002481 AGGAAATCAA AAGAAAAAAA AAAAAACCCT CAAGGGTATA GCTTTTGTAT ATAGCCCTAG TGAGCAAACT GCAAATTGGG 002560
002561 ACATGCAGTA GATTCTGGAG CAATCTCCAA TCCTTACCAG GTACTTCCTG GCATCAAATC CCCAGGACAT TTCTTGGCCC 002640
002641 CTCCTTGCAT TTTCCGTTTC AAAATGTTGA GGTTAAAATA CATCGAAGCA CAGAGGGAAG AAAATCTCAG GTCTTCTAGA 002720
002721 AATGGCGATG TCTTCATTTA AAAATAGGAC TGATGGGGGC TTGGCAGGGG TCTCTAGGAT CCAAAAGAGG TTGAGTTGCA 002800
002801 TCCTGCAGCC CAACTGTCCA CATTTAGAAG TGACAACATT CATGAACTAA GTCAACATCC ACCAAAAATA ACATGAAATA 002880
002881 AAGCTCACAG TTT
[back to top]

Predicted Small Protein

Name Lnc-DHX37-1:1_smProtein_77:235
Length 52
Molecular weight 6005.7654
Aromaticity 0.0769230769231
Instability index 65.6576923077
Isoelectric point 9.02130126953
Runs 9
Runs residual 0.0227075184702
Runs probability 0.0473316453708
Amino acid sequence MHLKQVHVSGSEWNSPGEFGSHHVYLRNRSLKSLNNIHKNICICFPDTCNQK
Secondary structure LLEEEEEEELLLLLLLLLLLLEEEEEELLLHHHHHHHHLLEEEELLLLLLLL
PRMN -
PiMo -

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[XfQLG@HB8DkddJ@fTmHXCAAAAAU] 2019-12-13 22:05:17: Fatal exception of type "TypeError"

Navigation menu