LINC00491

From LncRNAWiki
Jump to: navigation, search

Annotated Information

Approved Symbol

LINC00491

Approved Name

long intergenic non-protein coding RNA 491

Previous Symbols

_

Synonyms

BC008363

Chromosome

5q21.1

RefSeq ID

NR_103753

OMIM ID

_

Ensembl ID

ENSG00000250682

pubmed IDs

25200694

Disease

Disease: pancreatic ductal adenocarcinoma (PMID:25200694)

Dysfunction type: expression

Description: LncRNA BC008363 may be a novel biomarker for the prognosis of pancreatic cancer


Function

Function Mechanism: NA (PMID:25200694)

Biological Process: pathogenic process

Description: biomarker

Sequence

>gi|514239952|ref|NR_103753.1| Homo sapiens long intergenic non-protein coding RNA 491 (LINC00491), transcript variant 1, long non-coding RNA

000001 GACTCGGAAA GGGAACTCCC TGACCCCTTG CGCTTCCCGA GTGAGGCAAT GCCTCGCCCT GCTTCGACTC GCGCATGGTG 000080
000081 CGCGCACGCA CTGACCTGCG CCCACTGTCT GGCACTCCCT AGTGAGATGA ACCCGGTACC TCAGATGGAA ATGCAGAAAT 000160
000161 CACCAGTCTT CTGCGTCGCT CACGCTGGGA GCTGTAGACC GGAGCTGTTC CTATTCGGCC ATCTTGTCTC CTCCCGTGTT 000240
000241 TTCCAGGTGT ATTCCACATT GTCTCTACTA GTGAACTAGG ATAATCCATT GTGTATCTCA ACCTCCTTCA CTACCCTGTG 000320
000321 AAAGTCACAT GTGAGAAGAA GCATCACAGA TGATTCCATG GAGAACATCC TGGAAGTTCT CCAAATGAAC TGGAAATTCC 000400
000401 CTGTCTCCCC TTAACCAGCA CTGGAAGCAG ATGGGAAGAG AATAGCTGTG ACTGACTCAC ACTCTAACCC AGCAACCCTC 000480
000481 AGCATACAAG TGGGAGACCA TAAAGTTTTT CAAGACCCCA AAAGAGGCCA AAGGTCTGAT AATTGCTGGG AGAAGGTCCA 000560
000561 CTATCCAAGA AGAGAAGAGG AAAAGGAATT AAAGTCTCCA AGCACTGGGG ATGCAAGAAG AGAGTTGCAC AGGAGAGAAA 000640
000641 GAAGAAGTTG TCCACGGGGT GACCCTGCAA TTGGAGGGAA ATGCATGTGG ATATGTGCAG GGAGTCTAGG AAGTGAAGCC 000720
000721 TTAGTGATCA TTTACAAGAA TGAGGGTTAG GTAAAATAAG GGATGCAAAG CCACCTGTAG TCTATTCTAA CCTCACTCCA 000800
000801 TCACTCTATA CAATCTGTGT TTTATCATCT GAAATGTTAA GTAAAGACCT GTTTGGGTCT TCTTCAGAAT CCCATACATT 000880
000881 TGAGTTCATT AGTCAGAAAA AGGGAAAATA CCACCACCCC ATCCTGGAAT GGCAGTCATG TACACTTTTA TAATGAGAGA 000960
000961 TTGGGCAGCA AAGGGGGCCC CTTGTGGACC TCACCCAGCC AGAGAAGGAG GCAGAATGTT TCCTTTACTA TCTTTTCCTC 001040
001041 TCCCCAGAGG AACACTACAT ATTGTTCCCT CCATGGGCTT AAGAGAAGGT GCCAGGGTTA CAGATAGATA TATCGCTAGC 001120
001121 TGTAGAGCAC AGGGTGAATT GGGATGTCCA TGTACAAAGC TAGGGACAGG AGAATCAGTT TAAAGACTTT AAAAATAATT 001200
001201 AGGAAAAAAA GGAAGGCCTG ACCCAAAGCT TAGGAGTGCA GGTAGAGAAG AGATGGTGCC ATGATATACC ATGTCTCTGG 001280
001281 GACTTTTCTG TATTCCTCTT CCTCTGTATA CTGTATTGCC CTCATTCCCT ATTTATTCAA AATCTGTGCT ACCTCCACTG 001360
001361 CGAAGACTTC CACGAGAAAA TTCAGATATT TCTTCTTTTG TGGACACTTT CTACCTTACA AATAAGTTAA TTTTAATTCA 001440
001441 AGGAAGAGTT TTTCCGGAAC CCTGTTGGCC TGCTCACAGG AATGTAAGTT CCTTAAATCT AGGGCACAGT GTCTTTGAGA 001520
001521 ACTGCAATCA CCTACATCAA CATGACATAG CTATTAGGAC TAAGAACAGA GACCACCTGT GTCAACATGA GTTACTATTT 001600
001601 TTTTCCGTGA AACATTTGTC CAAGAAAGAT AAGACTGTAA CCAATAAATA GTTTGCAAGT AA

Predicted Small Protein

Name LINC00491_smProtein_833:952
Length 39
Molecular weight 4541.1235
Aromaticity 0.128205128205
Instability index 62.8076923077
Isoelectric point 6.80987548828
Runs 6
Runs residual 0.0148944193062
Runs probability 0.0214773597126
Amino acid sequence MLSKDLFGSSSESHTFEFISQKKGKYHHPILEWQSCTLL
Secondary structure LLLLLLLLLLLLLLLEEEHHHHLLLLLLLLLLEEELLLL
PRMN -
PiMo -

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[XeyOZwdu6YZPc8nKrsXAewAAAAk] 2019-12-08 05:47:22: Fatal exception of type "TypeError"

Navigation menu