CASC9

From LncRNAWiki
Jump to: navigation, search

Annotated Information

Approved Symbol

CASC9

Approved Name

cancer susceptibility candidate 9 (non-protein coding)

Synonyms

LINC00981, ESCCAL-1

Chromosome

8q21.11

RefSeq ID

NR_103848

Ensembl ID

ENSG00000249395

Sequence

>gi|523498737|ref|NR_103848.1| Homo sapiens cancer susceptibility candidate 9 (non-protein coding) (CASC9), transcript variant 1, long non-coding RNA

000001 TGAGATGAAG CCGGTACCTC AGATGGAAAT GCGGAAATCA CCGTCTTCTG TGTCGCTCAG GCTGGGAGCT GTAGACCGGA 000080
000081 GCTGTTCCTA TTCGGCCATC TTGGCTCCTC TCCCTCTTTA AAGTGATTGC TCACTGATGC CTTATCTAGT TCTCTTGGTG 000160
000161 AGGTCATGTT TTCCTGGATG GTCTTGGTGT TTGTGGATGT TCATCAATGT CAGGGCATTG AGAAGTTAGA ATGTGATTTT 000240
000241 GAAGAAAGGA GGAAAGATGT GAAAAGTGAT TGGTCAGCCA CATTCATGGT GTTGAGAAAA GAATTTGCTT TTCTGGAACA 000320
000321 TAGCCTGTGA TAGCAGAACA ACACCTGGCA AGAAACAGGT TATGTTTGGC TGGAGAGTCA TTGGCACTAT CAAGAAATAT 000400
000401 TAAAGTGTAG ATTTGAGAGA GGAGGAGAAA GACCCAAGCA AAATTGAAAA CCAGGTGGGA CCCAGACAGC AGCAAAGCAA 000480
000481 TGGAAGCATG TATTTTGGTC AATATAGAGT TAATACACAA TTTTGCCCCT CTTCTTCTGA TCATGGGACT CATATTACCA 000560
000561 GTCTTCACAT TTCCTTTAAA TTCAGGAATC AGGAAGAATT TCCAGAGTTT GCAGATGGAC ACATTTGCTG CTTCCATTCT 000640
000641 AAACATAAGT TAGAAGAACC TTTCAACTGG ATTCCAACTT TAATATGTCA CAAACATAAA AAAGAAAGCT ATTTCCTGGA 000720
000721 CTTTTCTTCA TTAGAAATTA ATAGATTGTC AATTGGCATA GGGAAAAGAT AATCAACAGA TGCCAACCCC AAGTTAACAG 000800
000801 AAATGCTAAA ATTATAAGAC AAAGACTTCA AAATAGCTAT TTTAATTTTG CCTAGTGAGG TAAATGCAAA CATGCTCACT 000880
000881 ATGAATGAAA ACAGGTAATC TCAGCAGTCA TGTAAACTAT AAAAATAAGC AAATATAAAT TTTAGAATTA AAACACAATA 000960
000961 TCTAAAAATA AATTCACCTG ATATTCTCAA TAGAAAAAAT GGTAATGCAG AGAAAAATGT ATGAAAATAT GGCAATTTGA 001040
001041 AGAAGAGAGA AGAGATCAAT AAAATAAATA AGTATATCCT TGGAGACCTG TGGATGTTTT TTGAAAAGTG AATCATGTAA 001120
001121 GTAATTGAAG TCCCAGAAGA AAAGAAAAGA AGAGGATGAG CAGAAAAAAA TTTCTGAAAA AATATCTGAA AGCTTAAACA 001200
001201 CTATAATGAA AGACACACAT TTACAAACTC AAGAAGTTTA GTAAACCAAA AACAATAAAA TCAAAGAGAA CTGTGCCAAG 001280
001281 CGACATCATT TTCAACCTGC TGAAGATCTT GACAGCAGTC AGAGAAAAAA GACACACTTA TTACACAGAG AGGAACAATA 001360
001361 CATTAAATAC TAGCACACTT CTCATCAGAG ATCATTAAGC CCAGAAGACA GTGGAATGAG ATCTTTAAAG TGCTGAAATA 001440
001441 AAATAAATGT TGATTAAAAA ATTCTATAGC T

Function

CASC9 functions as an oncogene by negatively regulating PDCD4 expression through recruiting EZH2 and subsequently altering H3K27me3 level.[1] Knockdown of CASC9 inhibited ESCC cell growth in vitro and tumorigenesis in nude mice.[1]

Labs working on this lncRNA

  • Department of Medical Genetics, College of Basic Medical Science, Third Military Medical University, Chongqing, China.

References

  1. 1.0 1.1 Wu Y, Hu L, Liang Y, Li J, Wang K, Chen X, Meng H, Guan X, Yang K, Bai Y. Up-regulation of lncRNA CASC9 promotes esophageal squamous cell carcinoma growth by negatively regulating PDCD4 expression through EZH2. Mol Cancer. 2017 Aug 30;16(1):150. doi: 10.1186/s12943-017-0715-7. PubMed PMID: 28854977; PubMed Central PMCID: PMC5577767.

Predicted Small Protein

Name CASC9_smProtein_479:652
Length 57
Molecular weight 6347.5749
Aromaticity 0.0877192982456
Instability index 78.9894736842
Isoelectric point 5.42608642578
Runs 7
Runs residual 0.0311403508772
Runs probability 0.0333989451636
Amino acid sequence MEACILVNIELIHNFAPLLLIMGLILPVFTFPLNSGIRKNFQSLQMDTFAASILNIS
Secondary structure LEEEEEELHHHHHHHHHHHHHHHHHHHHLLLLLLLHHHHHHHHHHHHHHHHHHHLLL
PRMN LLLLLLLLLLLHHHHHHHHHHHHHHHHHHHHHLLLLLLLLLLLLLLLLLLLLLLLLL
PiMo oooooooooooTTTTTTTTTTTTTTTTTTTTTiiiiiiiiiiiiiiiiiiiiiiiii

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[Xetvy4VipY-juMf1ITLojQAAAAQ] 2019-12-07 09:24:30: Fatal exception of type "TypeError"

Navigation menu