Difference between revisions of "NONHSAT122730"

From LncRNAWiki
Jump to: navigation, search
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
 +
 +
 +
==Annotation==
 +
===Name===
 +
NONHSAT122730
 +
 +
===Alias===
 +
NA
 +
 +
===Disease===
 +
Disease: papillary thyroid cancer [http://www.ncbi.nlm.nih.gov/pubmed/27758138 (PMID:27758138)]
 +
 +
Dysfunction type: NA
 +
 +
Description: The lncRNAs NONHSAT122730 was associated with lymph node metastasis
 +
 +
 +
===Function===
 +
Function Mechanism: NA [http://www.ncbi.nlm.nih.gov/pubmed/27758138 (PMID:27758138)]
 +
 +
Biological Process: pathogenic process
 +
 +
Description: therapy target
 +
 +
 +
 +
 +
 +
 +
 +
 +
 +
 +
 +
 +
 +
 +
 +
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
  
Line 42: Line 81:
 
sequence = <dnaseq>GAAACCGTTTCTACATGGCTGGCTCTAAGCCAGATGATATTTCATAGTGCAAAGAGGGATAGAACCTCACTGGTGGCCAAATGTGATTATATGCTATAACCCTGTGCCCCTACTCTGACACCCACCCCCAAGCAGTTACCCTCTGTTGGAAGCCTGCAGCTTTCTTTGTTTGTTTCTTTAATTATACAGACAGTAGGATCTGCATCCTTACTAGCATATAGAAAAATCAGAGAAACAATGCAACCAAGAGTGCTGTTTTCATTTGTTTCTTCTGCATCCTTTTAATGGAATTTTGTAGGTCTCTTGAAAGTGATGCAGAAGACCACAAGCCTTTGAAAAAAGGAAGTCGAACTCCTTCAGACAGGACTGTGAAAAAAGAAGATAGTGACGACAGCCTAGTTGACTATGGAGAAGGGGTTAATGGCCAGTTCAATGAGGATGGCTCCTTTATTGGACAATACAGTGGTAAGAAAGAGAAAGAGCCGGCTGAAGGAAACGAAAGCTCAGAGGCACCTTCTCCTGTCAACGCCATGAATTCCTTTGTTTAATTTTTAAGCTCTTTGCCAATATTCCATTTCTCTAGAATGTTTATCCTAAGCACTTGTTTGTCAGCCCTCTCATACTATGAACATATGGGTAGAGAGTATATTTTCTGCTGTATGTTAGTATTATGAGAATAGTTACAGCAAAAACATAACTCAGTCAAATGATATGTTAATATGAACTGGAATGCAAAGTGCATACTTTTTCATTCAAAATGGGTATTCTTGATTTCCTCAGAACTGATAAAAAATAATGCAACATCACCAACAGATCCTGTTATTTCCTCTGCAGGATACAGTTCAATATGATGCATGAAAAATGCTCCACATTTAAAGGACATACCCGTGTATGTTATGAAAACATGGTTTGATACTTTGTTTATACTACCCTCAGCTGAACCCCTATATATGAATTCCGTTTTCATTGTCAAGAATGTTACTGTAGTATTCTCTAGAACTTCAATGTCTTTGTGGACATTGTTGTGAAATTGGTGACTATGTATAGCTGTCGTTAGTCTTTTTGGGAGACTGTTAGGAACAGTTTGTACAGTATATACTTGCTAAATGAGTTCATTATGACAGTCACATTGCTGATGCTTACTGAGAACTATTACCTACTCTTGGCTCCTGTTACTCCGTAGGCTTCTTAATCTTCCAGGCATTACAGCAGCACAGTGTTCTACTTTTTACATCATTTCTATGTTCGGTTGTTTTTAGGCATAAACAATGTGTATTGCAGTGCATTTCGGCATTTGTGCCATACTGAAAGAATCAAAAACAAATCATCCAAATTAAATTTCAAACATTATTTCAGAGAACACAGGGCAAGACACATACAGTGCCTTCAGATATTAAGCATTCCACAACATCGTGCATTCTGTATCAGCTGGTCCAGTCCATTCTGGGTCCTAGATTACTGTCATTGTCTAAAAGTAACTTTTAAAAAGCAGAGTTCATGAAAACTGCAATGCTGGGAAAAGAAGGAAACATGAAAATAAAAATAAGACAGTTTATTAGAAATAGCATTTCCTCATAAGCATAAAAAGAAAATCTTTGTTGCCAACTGAAGCACATGATGATTTTGTGGTCCTTTATGGTTTCTATTACATTCAGTAAGAAAGATGTCAACATGCTAGAAAATTAATTTTAAAACTAAGTTATTCCAACACTAAAAGCATACAACAGCATGCCAACAGTAATATATTATTCTCCAAGACTTTACCTATGTAAGTGTTCAAAACTCTGCAGCATTAAACAACGTGTATGCAAATTGTTATGGATACATTTCAGAATCTAAGAAATCAGGCAAGTGCTTAAAAGGCCAACGGTCCAAGGGATTACATCTGCAGTTTAAAAAGTAAATATATATTCTATCGTATTCATAAACAATATCTATCAAATGGGTTACCTCCAAATATGAAAATCTATAACAACCTATGGTTGAAGGAATGCTCAGTTTCATTTGCCAATAAATTGGTTTCTCATAACTTGCATCAAGTTTAATTTTAAGTAAAGCTTTTTATATGTAGATATTTTGTTGAATTTGTAAATACACTTAAAATGTAGATGCTATATGCTTATAGGTGTTACATACAAATAAACATGCAATGTTTATGTTGTACTGTATAAGAGGTAAGCTAATTAATGCAGTGAATGGGATTGGAAAGCATCTACTTAAATATCTATTGGGTTCCCCCCTCCCCCCACCTTTTTTGCTGTGAAACTGAAATAGTGAACTTTTCTACGTATTGACAGCAGATTTTTCGATGAAATCTTCAGAGCTTTGCCTATGGGGCACAGTAGGCCTAGTAACCTGGCATGTTTGATATATGTAGGTAAAGCATAATTTAAAGTAATCCCAGGTAAAGATGGCCCTAAATACTTTCATGTCTCTATATTCATTTTTCACAGATCCACCTGTCTCTTGAAAATATAAAAAGACAAAACAGGTTTGCCTTGGCATCAGAGAGCACAAAGATTAAAAGTTACTTTAAATTTGCCAATATTTTGGGAGAACAATAAAACTACATTTTTTCCTCTTCCATACTGGTAGATGCGAAATTTATCTGTGCATGAAAGGGTCACTTCTGTAATAGTGCAACAGATTTGGTATTAAAAATTAAATGTGGTTTTAAAAGTTCCTCTCTCTTTTGTAATTTATGTTCCCAATTGAGTGTGAATGTCCAAGTAATGGTGTATGTAATGGTACAGGCAAATGTGACTGGATTTCCCTCAAAAAAGTAACTATTAAACAGTCTTGATCTCTTTGTGACTTTTAACTTTTTCAAACATA</dnaseq>|
 
sequence = <dnaseq>GAAACCGTTTCTACATGGCTGGCTCTAAGCCAGATGATATTTCATAGTGCAAAGAGGGATAGAACCTCACTGGTGGCCAAATGTGATTATATGCTATAACCCTGTGCCCCTACTCTGACACCCACCCCCAAGCAGTTACCCTCTGTTGGAAGCCTGCAGCTTTCTTTGTTTGTTTCTTTAATTATACAGACAGTAGGATCTGCATCCTTACTAGCATATAGAAAAATCAGAGAAACAATGCAACCAAGAGTGCTGTTTTCATTTGTTTCTTCTGCATCCTTTTAATGGAATTTTGTAGGTCTCTTGAAAGTGATGCAGAAGACCACAAGCCTTTGAAAAAAGGAAGTCGAACTCCTTCAGACAGGACTGTGAAAAAAGAAGATAGTGACGACAGCCTAGTTGACTATGGAGAAGGGGTTAATGGCCAGTTCAATGAGGATGGCTCCTTTATTGGACAATACAGTGGTAAGAAAGAGAAAGAGCCGGCTGAAGGAAACGAAAGCTCAGAGGCACCTTCTCCTGTCAACGCCATGAATTCCTTTGTTTAATTTTTAAGCTCTTTGCCAATATTCCATTTCTCTAGAATGTTTATCCTAAGCACTTGTTTGTCAGCCCTCTCATACTATGAACATATGGGTAGAGAGTATATTTTCTGCTGTATGTTAGTATTATGAGAATAGTTACAGCAAAAACATAACTCAGTCAAATGATATGTTAATATGAACTGGAATGCAAAGTGCATACTTTTTCATTCAAAATGGGTATTCTTGATTTCCTCAGAACTGATAAAAAATAATGCAACATCACCAACAGATCCTGTTATTTCCTCTGCAGGATACAGTTCAATATGATGCATGAAAAATGCTCCACATTTAAAGGACATACCCGTGTATGTTATGAAAACATGGTTTGATACTTTGTTTATACTACCCTCAGCTGAACCCCTATATATGAATTCCGTTTTCATTGTCAAGAATGTTACTGTAGTATTCTCTAGAACTTCAATGTCTTTGTGGACATTGTTGTGAAATTGGTGACTATGTATAGCTGTCGTTAGTCTTTTTGGGAGACTGTTAGGAACAGTTTGTACAGTATATACTTGCTAAATGAGTTCATTATGACAGTCACATTGCTGATGCTTACTGAGAACTATTACCTACTCTTGGCTCCTGTTACTCCGTAGGCTTCTTAATCTTCCAGGCATTACAGCAGCACAGTGTTCTACTTTTTACATCATTTCTATGTTCGGTTGTTTTTAGGCATAAACAATGTGTATTGCAGTGCATTTCGGCATTTGTGCCATACTGAAAGAATCAAAAACAAATCATCCAAATTAAATTTCAAACATTATTTCAGAGAACACAGGGCAAGACACATACAGTGCCTTCAGATATTAAGCATTCCACAACATCGTGCATTCTGTATCAGCTGGTCCAGTCCATTCTGGGTCCTAGATTACTGTCATTGTCTAAAAGTAACTTTTAAAAAGCAGAGTTCATGAAAACTGCAATGCTGGGAAAAGAAGGAAACATGAAAATAAAAATAAGACAGTTTATTAGAAATAGCATTTCCTCATAAGCATAAAAAGAAAATCTTTGTTGCCAACTGAAGCACATGATGATTTTGTGGTCCTTTATGGTTTCTATTACATTCAGTAAGAAAGATGTCAACATGCTAGAAAATTAATTTTAAAACTAAGTTATTCCAACACTAAAAGCATACAACAGCATGCCAACAGTAATATATTATTCTCCAAGACTTTACCTATGTAAGTGTTCAAAACTCTGCAGCATTAAACAACGTGTATGCAAATTGTTATGGATACATTTCAGAATCTAAGAAATCAGGCAAGTGCTTAAAAGGCCAACGGTCCAAGGGATTACATCTGCAGTTTAAAAAGTAAATATATATTCTATCGTATTCATAAACAATATCTATCAAATGGGTTACCTCCAAATATGAAAATCTATAACAACCTATGGTTGAAGGAATGCTCAGTTTCATTTGCCAATAAATTGGTTTCTCATAACTTGCATCAAGTTTAATTTTAAGTAAAGCTTTTTATATGTAGATATTTTGTTGAATTTGTAAATACACTTAAAATGTAGATGCTATATGCTTATAGGTGTTACATACAAATAAACATGCAATGTTTATGTTGTACTGTATAAGAGGTAAGCTAATTAATGCAGTGAATGGGATTGGAAAGCATCTACTTAAATATCTATTGGGTTCCCCCCTCCCCCCACCTTTTTTGCTGTGAAACTGAAATAGTGAACTTTTCTACGTATTGACAGCAGATTTTTCGATGAAATCTTCAGAGCTTTGCCTATGGGGCACAGTAGGCCTAGTAACCTGGCATGTTTGATATATGTAGGTAAAGCATAATTTAAAGTAATCCCAGGTAAAGATGGCCCTAAATACTTTCATGTCTCTATATTCATTTTTCACAGATCCACCTGTCTCTTGAAAATATAAAAAGACAAAACAGGTTTGCCTTGGCATCAGAGAGCACAAAGATTAAAAGTTACTTTAAATTTGCCAATATTTTGGGAGAACAATAAAACTACATTTTTTCCTCTTCCATACTGGTAGATGCGAAATTTATCTGTGCATGAAAGGGTCACTTCTGTAATAGTGCAACAGATTTGGTATTAAAAATTAAATGTGGTTTTAAAAGTTCCTCTCTCTTTTGTAATTTATGTTCCCAATTGAGTGTGAATGTCCAAGTAATGGTGTATGTAATGGTACAGGCAAATGTGACTGGATTTCCCTCAAAAAAGTAACTATTAAACAGTCTTGATCTCTTTGTGACTTTTAACTTTTTCAAACATA</dnaseq>|
 
}}
 
}}
[[Category:Sense]][[Category:NONHSAG048533]]
+
[[Category:Sense]][[Category:NONHSAG048533]][[Category:Transcripts]]

Latest revision as of 03:50, 7 November 2018


Annotation

Name

NONHSAT122730

Alias

NA

Disease

Disease: papillary thyroid cancer (PMID:27758138)

Dysfunction type: NA

Description: The lncRNAs NONHSAT122730 was associated with lymph node metastasis


Function

Function Mechanism: NA (PMID:27758138)

Biological Process: pathogenic process

Description: therapy target









Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

NONHSAT122730

Source

NONCODE4.0

Same with

,

Classification

sense

Length

2835 nt

Genomic location

chr7-:107788068..107797082

Exon number

3

Exons

107788068..107790592,107791140..107791198,107796832..107797082

Genome context

Sequence
000001 GAAACCGTTT CTACATGGCT GGCTCTAAGC CAGATGATAT TTCATAGTGC AAAGAGGGAT AGAACCTCAC TGGTGGCCAA 000080
000081 ATGTGATTAT ATGCTATAAC CCTGTGCCCC TACTCTGACA CCCACCCCCA AGCAGTTACC CTCTGTTGGA AGCCTGCAGC 000160
000161 TTTCTTTGTT TGTTTCTTTA ATTATACAGA CAGTAGGATC TGCATCCTTA CTAGCATATA GAAAAATCAG AGAAACAATG 000240
000241 CAACCAAGAG TGCTGTTTTC ATTTGTTTCT TCTGCATCCT TTTAATGGAA TTTTGTAGGT CTCTTGAAAG TGATGCAGAA 000320
000321 GACCACAAGC CTTTGAAAAA AGGAAGTCGA ACTCCTTCAG ACAGGACTGT GAAAAAAGAA GATAGTGACG ACAGCCTAGT 000400
000401 TGACTATGGA GAAGGGGTTA ATGGCCAGTT CAATGAGGAT GGCTCCTTTA TTGGACAATA CAGTGGTAAG AAAGAGAAAG 000480
000481 AGCCGGCTGA AGGAAACGAA AGCTCAGAGG CACCTTCTCC TGTCAACGCC ATGAATTCCT TTGTTTAATT TTTAAGCTCT 000560
000561 TTGCCAATAT TCCATTTCTC TAGAATGTTT ATCCTAAGCA CTTGTTTGTC AGCCCTCTCA TACTATGAAC ATATGGGTAG 000640
000641 AGAGTATATT TTCTGCTGTA TGTTAGTATT ATGAGAATAG TTACAGCAAA AACATAACTC AGTCAAATGA TATGTTAATA 000720
000721 TGAACTGGAA TGCAAAGTGC ATACTTTTTC ATTCAAAATG GGTATTCTTG ATTTCCTCAG AACTGATAAA AAATAATGCA 000800
000801 ACATCACCAA CAGATCCTGT TATTTCCTCT GCAGGATACA GTTCAATATG ATGCATGAAA AATGCTCCAC ATTTAAAGGA 000880
000881 CATACCCGTG TATGTTATGA AAACATGGTT TGATACTTTG TTTATACTAC CCTCAGCTGA ACCCCTATAT ATGAATTCCG 000960
000961 TTTTCATTGT CAAGAATGTT ACTGTAGTAT TCTCTAGAAC TTCAATGTCT TTGTGGACAT TGTTGTGAAA TTGGTGACTA 001040
001041 TGTATAGCTG TCGTTAGTCT TTTTGGGAGA CTGTTAGGAA CAGTTTGTAC AGTATATACT TGCTAAATGA GTTCATTATG 001120
001121 ACAGTCACAT TGCTGATGCT TACTGAGAAC TATTACCTAC TCTTGGCTCC TGTTACTCCG TAGGCTTCTT AATCTTCCAG 001200
001201 GCATTACAGC AGCACAGTGT TCTACTTTTT ACATCATTTC TATGTTCGGT TGTTTTTAGG CATAAACAAT GTGTATTGCA 001280
001281 GTGCATTTCG GCATTTGTGC CATACTGAAA GAATCAAAAA CAAATCATCC AAATTAAATT TCAAACATTA TTTCAGAGAA 001360
001361 CACAGGGCAA GACACATACA GTGCCTTCAG ATATTAAGCA TTCCACAACA TCGTGCATTC TGTATCAGCT GGTCCAGTCC 001440
001441 ATTCTGGGTC CTAGATTACT GTCATTGTCT AAAAGTAACT TTTAAAAAGC AGAGTTCATG AAAACTGCAA TGCTGGGAAA 001520
001521 AGAAGGAAAC ATGAAAATAA AAATAAGACA GTTTATTAGA AATAGCATTT CCTCATAAGC ATAAAAAGAA AATCTTTGTT 001600
001601 GCCAACTGAA GCACATGATG ATTTTGTGGT CCTTTATGGT TTCTATTACA TTCAGTAAGA AAGATGTCAA CATGCTAGAA 001680
001681 AATTAATTTT AAAACTAAGT TATTCCAACA CTAAAAGCAT ACAACAGCAT GCCAACAGTA ATATATTATT CTCCAAGACT 001760
001761 TTACCTATGT AAGTGTTCAA AACTCTGCAG CATTAAACAA CGTGTATGCA AATTGTTATG GATACATTTC AGAATCTAAG 001840
001841 AAATCAGGCA AGTGCTTAAA AGGCCAACGG TCCAAGGGAT TACATCTGCA GTTTAAAAAG TAAATATATA TTCTATCGTA 001920
001921 TTCATAAACA ATATCTATCA AATGGGTTAC CTCCAAATAT GAAAATCTAT AACAACCTAT GGTTGAAGGA ATGCTCAGTT 002000
002001 TCATTTGCCA ATAAATTGGT TTCTCATAAC TTGCATCAAG TTTAATTTTA AGTAAAGCTT TTTATATGTA GATATTTTGT 002080
002081 TGAATTTGTA AATACACTTA AAATGTAGAT GCTATATGCT TATAGGTGTT ACATACAAAT AAACATGCAA TGTTTATGTT 002160
002161 GTACTGTATA AGAGGTAAGC TAATTAATGC AGTGAATGGG ATTGGAAAGC ATCTACTTAA ATATCTATTG GGTTCCCCCC 002240
002241 TCCCCCCACC TTTTTTGCTG TGAAACTGAA ATAGTGAACT TTTCTACGTA TTGACAGCAG ATTTTTCGAT GAAATCTTCA 002320
002321 GAGCTTTGCC TATGGGGCAC AGTAGGCCTA GTAACCTGGC ATGTTTGATA TATGTAGGTA AAGCATAATT TAAAGTAATC 002400
002401 CCAGGTAAAG ATGGCCCTAA ATACTTTCAT GTCTCTATAT TCATTTTTCA CAGATCCACC TGTCTCTTGA AAATATAAAA 002480
002481 AGACAAAACA GGTTTGCCTT GGCATCAGAG AGCACAAAGA TTAAAAGTTA CTTTAAATTT GCCAATATTT TGGGAGAACA 002560
002561 ATAAAACTAC ATTTTTTCCT CTTCCATACT GGTAGATGCG AAATTTATCT GTGCATGAAA GGGTCACTTC TGTAATAGTG 002640
002641 CAACAGATTT GGTATTAAAA ATTAAATGTG GTTTTAAAAG TTCCTCTCTC TTTTGTAATT TATGTTCCCA ATTGAGTGTG 002720
002721 AATGTCCAAG TAATGGTGTA TGTAATGGTA CAGGCAAATG TGACTGGATT TCCCTCAAAA AAGTAACTAT TAAACAGTCT 002800
002801 TGATCTCTTT GTGACTTTTA ACTTTTTCAA ACATA
[back to top]

Predicted Small Protein

Name NONHSAT122730_smProtein_284:547
Length 88
Molecular weight 9519.11
Aromaticity 0.0689655172414
Instability index 45.1298850575
Isoelectric point 4.53424072266
Runs 13
Runs residual 0.0111658456486
Runs probability 0.0319120025002
Amino acid sequence MEFCRSLESDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYGEGVNGQFNEDGSFIGQYS
GKKEKEPAEGNESSEAPSPVNAMNSFV
Secondary structure LLEEELLLLLLLLLLLLLLLLLLLLLLLEEEELLLLLEEELLLLLLLEELLLLEEEEEEL
LLLLLLLLLLLLLLLLLLLHHHHLLLL
PRMN -
PiMo -