ENST00000435043.2

From LncRNAWiki
Revision as of 11:51, 16 October 2014 by 192.168.72.52 (talk)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000435043.2

Source

Gencode19

Same with

,

Classification

intergenic

Length

1505 nt

Genomic location

chr6-:3182978..3195990

Exon number

3

Exons

3182978..3183960,3191061..3191491,3195900..3195990

Genome context

Sequence
000001 TGAAACATGC CTGTTTCCCC TTTGCTTTCT GCCATGATTA TAAGTTTCCT GAGGCCTTCC CAGCCATGCT TCCCGTACAG 000080
000081 CCTTCGGAAC TGTTTGACCA CATGATTTGC TTTGGCAGAT GGAACGTTAG CAGCTGGGGA CCTTTCTGCC ACCACAAAAG 000160
000161 CCTAGATTAT CCTGATGGAC GATGGAAGAC ACATGGCTGT TGTTCCAGCT GACATCAAGC CAACCACTGG ACAAGATAGG 000240
000241 AAAGCTCTCC TAGAACACGA AGGCCCGAAT GAACTGGCCC AGAGCAGAGA AACTGCTCAG CCAAACTGCC AAGCTGTGAT 000320
000321 TAACAAAGGC TTCATCTTAA TCCACCAGAT TTTGGGGTGG TTTGTTACAC AGCGAATGCT AACTGATACA GTCATTATCA 000400
000401 TTAGGTCTTT CTTGAGCTGA TCATACTTCC CAGCATAGAA TACGCCAATG TCCTGCTCCT TATTCCTGGC TGCCAGCATT 000480
000481 GTAAGAGCTG AGTGGAAGGC TGGGGTTTTC AGCACTCAAT ATGCACTAGA CAATCCAAAA GATCTACAAA AACTTTACAT 000560
000561 CTACAAGCCA AGGCACTGAA TCTCAGCCCC AGAAAGAGAC TGTGACCTTC CTTCCTCATC AGGATCCCAA GAAGCCGTAG 000640
000641 AACAAGAGGC TAAGAGGTTC GAAGGACACT GGAAAGGCTT CATGCTGCTG TAGGTTGTGG ATGGACAAGC TTTGTGTCTG 000720
000721 GAGCTGCTGT AGTGGGCCAC TCAGTTAGTT CACCCAGGCT CCCACATTCT CCATGCTCTG TTTCAGGAAA CAACCAGAAC 000800
000801 TGTGGACAGT CTTACCAAAG ACACTAACAT CATCACCAGA GAATTAAAGA AATCCAGTGA GTGGCCCACA ACAATTGGCT 000880
000881 GGCATAGGAC ATGATCCTAG CTTCCCACAG GGCACTTGGG ATTGTGCAGT CAGAAGTGAT TGATGTGCAT ATGTTTCCAC 000960
000961 AGACCTCTCT GATGTCTATG CCGTCACCAA AAATATTCAG ACTGCAAACC AGGAAATGCA TTGAATTGCC ACCATTGTCC 001040
001041 TTATACTTCC GTTTAAGGAC ACTCCAGGCC CAACGTCTCA AGGCCTTTTA GGCTAGCTTC CTTCAAACCT CAAATCTTGG 001120
001121 TTGCTGTCTA ATTTAACCTT TAACCCTTTT ACCATTTGCC CTGAGAACAC TTGCCGGCAG CACTTCCAGC TGCAGCGTTT 001200
001201 ACCCAAAGAT ACCTCTGCCA GGAAAGACCT TGCTTTTATT ATTACTTTTG CATTTCTCTA GCATATTGAC ATTGGAAACA 001280
001281 AAAGACATCA TTCTATATAT AGCATTCTGG TTTTAGTGGT GGTAGTTCCA TTTACAAAAT ATAGTAATTC TTGATCACTG 001360
001361 AAAATGTCAG AGCCTAGAAA ACGGAGCATT CCTATGCGTG ATGTTAACAT CATTAAACAG TTGTTGGCCA AAGACTCATG 001440
001441 TGATGAATCC AATTTTTCTA AAATAAATAG CTCAGATGAT TCAGATGATT CTGATATTAG GTCTG
[back to top]

Predicted Small Protein

Name ENST00000435043.2_smProtein_890:1090
Length 67
Molecular weight 7655.1531
Aromaticity 0.0757575757576
Instability index 71.2151515152
Isoelectric point 10.9097290039
Runs 11
Runs residual 0.0160587915079
Runs probability 0.0468677233383
Amino acid sequence MILASHRALGIVQSEVIDVHMFPQTSLMSMPSPKIFRLQTRKCIELPPLSLYFRLRTLQA
QRLKAF
Secondary structure LHHHHHHHLLLLHHHEELLLLLLLLLLLLLLLLHHHHHHHHHEEELLLLLHHHHHHHHHH
HHHHLL
PRMN -
PiMo -