ENST00000429328.2

From LncRNAWiki
Revision as of 03:40, 26 August 2015 by Chunlei Yu (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Name

PDZK1IP1-AS1

Characteristics

Spliced, two exon 661nt transcript.

Transcribed bidirectionally with CYP4A22-AS1.

LincRNA catalogue from deep RNA sequencing suggests variation in transcript length and also potential alternative splicing ((Cabili 2011)).

Expressed downstream of TAL1 and PDZK1IP1 on the opposite strand.

In-vitro translation showed no sign of protein product.

Function

PDZK1IP1-AS1 expression appears to stimulate CMPK1 gene expression (in Jurkat cells). A gene located over 150 kb 3’ of PDZK1IP1-AS1 on the same strand.

Expression

Expressed in Jurkat cells, but not in MCF7 cells (unlike CYP4A22-AS1).

Conservation

Please input conservation information here.

Misc

Please input misc information here.

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Regulation

Please input regulation information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Annotation originally sourced from lncRNAdb.

Basic Information

Transcript ID

ENST00000429328.2

Source

Gencode19

Same with

lnc-CYP4A22-2:2

Classification

intergenic

Length

661 nt

Genomic location

chr1+:47644922..47646011

Exon number

2

Exons

47644922..47645110,47645540..47646011

Genome context

Sequence
000001 GCCGCGCCTG AAGCTCAACT TCCGAGGCTC TCATCAATCT ACGCTTCCTT TGGAGCGTGC AGCCACCAGG TGGCAGCCGA 000080
000081 GGCCACGGGC AGACAGAAAA GCTCCCGAAA CTGAAGGACT GCCAGGCAGC AGAGTTCCGG AGGGCTCCCA GGACCTTCAA 000160
000161 CCAGAAAGAG ACAGAGCATA TGCGCATATC CCTGCAAGGA ATGTACTATA GAGCCAATTT TACCGGCAAA GGAATGGAAG 000240
000241 ATCTGAAAGG CTAGGCGATC CCACAAGCAT CGAGGAGCAG GCTGGAATTT GAACCAATCG GCATGATTCC CAAGCTCAAG 000320
000321 CTTTTGGCCA CCCCTGCACT GCCAGGGACA AAAAAAAAAA AAAAAAAAAA CCCTGGGAGG AGAGCCAAGC TAGGGAGTCA 000400
000401 AGACCCTCCA GCCAGGTCTG GATGGGAGGC AGGTGCCTCC ACCCTGGTCC CAGAGCAAGT TCTGCTGGCT TCAGCCACCT 000480
000481 GACTTCCCTG TGAAGGTGGG TAGAGGCCAG AGCAGACTGT GTGTGATTCT GGCCCCAGCC CCAGCACCTC TACCCCCACC 000560
000561 TTTACTACCC CTAGGCTGCG GGAAGAGGCT TTGCCCAGCA ATAGTCCTGA TCTAATGGAT CCTTGAAGCA CAATAAACAG 000640
000641 ATAGTATTTC TGCATGTGTC A
[back to top]

Predicted Small Protein

Name ENST00000429328.2_smProtein_302:481
Length 60
Molecular weight 6204.2967
Aromaticity 0.0169491525424
Instability index 47.2508474576
Isoelectric point 10.8190307617
Runs 8
Runs residual 0.00886331830197
Runs probability 0.0172893481718
Amino acid sequence MIPKLKLLATPALPGTKKKKKKNPGRRAKLGSQDPPARSGWEAGASTLVPEQVLLASAT
Secondary structure LLLLLEEELLLLLLLLLLLLLLLLLLLEELLLLLLLLLLLLLLLLLLLLHHHEEEELLL
PRMN -
PiMo -
Name ENST00000429328.2_smProtein_302:481
Length 59
Molecular weight 6204.2967
Aromaticity 0.0169491525424
Instability index 47.2508474576
Isoelectric point 10.8190307617
Runs 8
Runs residual 0.00886331830197
Runs probability 0.0172893481718
Amino acid sequence MIPKLKLLATPALPGTKKKKKKNPGRRAKLGSQDPPARSGWEAGASTLVPEQVLLASAT
Secondary structure LLLLLEEELLLLLLLLLLLLLLLLLLLEELLLLLLLLLLLLLLLLLLLLHHHEEEELLL
PRMN -
PiMo -