ENST00000304751.9

From LncRNAWiki
Revision as of 14:39, 16 October 2014 by 124.16.129.48 (talk)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000304751.9

Source

Gencode19

Same with

lnc-ZNF705A-2:1

Classification

intergenic

Length

795 nt

Genomic location

chr12+:8388011..8391542

Exon number

2

Exons

8388011..8388595,8391333..8391542

Genome context

Sequence
000001 GGACCCGGCT GTGAGGGTCG CTGAAGATGT ATGCCCGGGG GCGGCACATC TTGCAGATGG CAAGGCCTGT GAGGCCGGCA 000080
000081 CCACTGCCAA GTTCTAGGAC AGTCCTGGCG GGAGGAAAGG GGACCGTGTC TTCGACTGCA CCAGGGTAAG CCTGCCTTGG 000160
000161 TGCCCTGCCC TGTGCCCCGA GGTCACCTGT TAGTGAAGGC TGCTGGGTTC TCGATGGCCC ATTCTGCAAG GCAGAGGGTG 000240
000241 GCGTCCCATG TGACCAGGCC TGTGGTACCG TGAGAGATGA TGGCTGTGCT CTCGGAGATT GTGACCGAGC CTCCCGAGGG 000320
000321 CTGCACCAAG AGAGGGCGAG AGAGTCAGTC CAGCGATCAG AAGGCAAGTG GCTTAGAAGA CAAGTAGCCA TCCACCACAT 000400
000401 GGCTGAATAA ACCATGACAG GACCAATCGC CACTCAGCAA TGAGAAGCAG CTAACTGTTG ACATACCAAC AGCTTTCACG 000480
000481 GGCCTCAAGA TTGTCACGTG GCATGAAAGA CACTCATCTC AGGCCACACA GGATTCCATT CATCGAACAT TCCTGAGACA 000560
000561 ACGGAATTCT GGCGATGGAG CACAGGATGC TTCACAGTCT ACGGCAAAGG ACAGAACGTT GGTTGCTCGA GAGCCCGTCT 000640
000641 TAAGTCTCCT ATGAGCTTCA AGCCAACACA ACAGAGGGCA AACTCCAGGC TACCTGATCC CTCAGCAAAG ATGCAGATGG 000720
000721 ACACAGCGTT CTGGCCCCAC GCATCTGAAG TTCGTCTTAA GATGTAAGCC GTTTCCTAAA AATGCTTCCA CTGCA
[back to top]

Predicted Small Protein

Name ENST00000304751.9_smProtein_26:148
Length 41
Molecular weight 4145.8161
Aromaticity 0.025
Instability index 101.0
Isoelectric point 12.180847168
Runs 8
Runs residual 0.0219758064516
Runs probability 0.042594064653
Amino acid sequence MYARGRHILQMARPVRPAPLPSSRTVLAGGKGTVSSTAPG
Secondary structure LLLLLEEEHHHLLLLLLLLLLLLLEEELLLLEEEELLLLL
PRMN -
PiMo -