STX18-AS1

From LncRNAWiki
Jump to: navigation, search

Annotated Information

Approved Symbol

STX18-AS1

Approved Name

STX18 antisense RNA 1 (head to head)

Previous Symbols

_

Synonyms

LOC100507266

Chromosome

4p16.2

RefSeq ID

NR_037888

OMIM ID

_

Ensembl ID

ENSG00000247708

pubmed IDs

23708191

Sequence

>gi|323641476|ref|NR_037888.1| Homo sapiens STX18 antisense RNA 1 (head to head) (STX18-AS1), long non-coding RNA

000001 GAAAAAGGTT CCGGCCTCAG CCGGCGCACC TGGCGGAGGA GGAACCTCGC GACGCGCTCT CGGGCATCGG TTTCTCCCAG 000080
000081 CAAAGCTTGG AGGGTTTAGC TGCGCGGAGA GCTCAGCGAG CTCTTCTGTG TCTGTTTGGG GCGTGTGGGC TCCGGGAGCG 000160
000161 TGAGGACCGG GAAGCTAGGA GGCTCCTTCC CTTCTGGCGG CTCCCTCACT GAGACCGGGC GGTTTGGTTG CGGGGGAAGT 000240
000241 GGAGACGAGC CACCCTTGAC CTTTGACTGC AAGAACTCAC CTTGAGCAGG ATAGAGGCAC GTGGACGGTG ACCCTCGGGA 000320
000321 TGCAATAAAT GCTGAGACAG ATCAGCAAAC ATTGAGTGGG CCAGACACTG TTCTGAAAAA TACGCAGTCG ACTTTTGAAC 000400
000401 AGCACAGGCT TGAACTGCAT GCGGCCACTA ATACTCGGAC TTCCTTCTGC CTCTGCCATC CCTAAGACAG CAAGACCCAC 000480
000481 CCCTCCTGCT CCTCAGCCTA CTCGATGTGA TGATGATGCA GAGATTCAGA GAGTCTAAGC AACTTTTCTA AATCATCTAG 000560
000561 CTGGAATTCA GTAACTGAGC CAGGATCTAC CCCAGGTCTG TCTGACTCCA AAGCCTGTGT CTTCCAGCAC ACACTGCTGC 000640
000641 TGCCTGGGGA ATGTGGATAT GATGTCTGGA GCTCTAGCAA CCATATCAGA CCACAAGGAT GAATGTACAC CCCAGGAATG 000720
000721 GAAGAGAGGA AAGCCAGAAA AAGACTCGGT CCCTGATGGC TGAAGAGCTA CCATACCTGC CCCTAGATCT TCTATTTCTG 000800
000801 ATCATCTTCT ATGCAAGGCC TGGAATGTAA TCATGGATAG CCATGGATGA TCAGCTTTCA TCATGTGGGC ATGGAACAAG 000880
000881 ATGGAAGGAA GCTGGGGCCC TGAGTGACCT GTGGAGCAGA GGCCTTTGCC CACCCTGGGC TGCCTGATTT CCCCTGGACT 000960
000961 ATCATGAGAC AGAAGAAAAA GCTTCTATCT TATTTGAACC ACTGTGTTTT GGGAACCTTG GACTAGAGCA GCCTAGCCTT 001040
001041 CATACACTAA CAAGGTACAT TACTGACTTC TCCTGTTAGC TCTGTCGTGC TTACATCATG ATGCCCATTT TTCAGGTAAA 001120
001121 GAAATAGTGG CTCAAACAAG GTGAGTGGCC AAAGATAACA TAGCTCATAT GTAGCAAAGC AGGGACTTTG ATCTGGGTCT 001200
001201 CAGCACTTTG TCCACCATGG TGTCCACTGG TTGACTCAGG TGATTCACCT GGGTAACAAG GCTTCCTGAA GGCCACCTGC 001280
001281 TGGTAAATGT CATTGCCAGT TCATTGACCG GGAGCCCCCA TGTGTTTCTA CCAAGACCCC GCTCCTCTCT TCGCATACAG 001360
001361 TAATCTGTTG TATACACTTT GTACCTCACC CACAAGCGTG TGAAAAGCCT TAGCTGTTCT GGTGCCAGGA CTAATGGGAG 001440
001441 CTGCTTACAG TCTATGAGGA CAATCAGACT TGGCCGCCTG CCTTCTTTCC ATATAATTTT TAATAAGCCA GTAATATCTC 001520
001521 TCCAAGCACT ACAGACCTCT GGCTTGGACC AGGAAACCTG GAACTGTTTA AGAGAACATT AATTTCCTTT GAGCTAGGAT 001600
001601 TACAGGCCAT CTAAAACTTC TTAATGAATG GCCACACTGC CTTTTTGAAG CATTTGTGTA TTTGCCAACA CAGACTCGAA 001680
001681 GGTTGCATTA GATATTGGGA GTTGTCTTTT CTGGAAGTTA GGGTCTTCTA GAAGCTGACG GGCGATGGAG GCCTGATGCT 001760
001761 CTGCCATTTC TTTGGTGAGA CCTCTGGACT GCTTCGTTCA TAGTCCTCTT TCCCACATAT GCTCCCCTGA TGTCTTACTC 001840
001841 TTTTATTTTA TGGGTTTTTG GTAACTGAAA CATTTTAAGA CTCAATTCCG CCACTTTGTT GAAGATAAAA TCAAGTTCAA 001920
001921 ACCCTGCTTT ATTTTATTTT TCTTTTTTTT GGACGGAACT AGTGAGGAAA CTGTGTGTGC AAACCCCAGA AAACCCACTT 002000
002001 GAGACCTGAT GCTAATTGGC TGGATGATGT TCAATAGGAC ACGGCTCCAC TGAGCCTCAA TTTCCTGATG AGGGTTAAAC 002080
002081 TGATGATTCT TAACCAGGTC TGACATTCTG TAAATTAAGC ATACTTGCTT CTGATTTCAC AGTTTCCATG GGATCAGAGG 002160
002161 ATTGAAATGT CAAGGAACCT CCCTTGATGT CCCCCTAAGA CTCTGAATTG AACTGTGATG AGGACCCTTT TGAGAATCTT 002240
002241 TCAGTGATCC CCTTCTCTAG GAAGGAAGGG TGAAGTATGC TTTGTAAGAG AGATTGTCTA TTTGTCTTTT ATCTCCTGAT 002320
002321 TTCAAACACA GTGGTTCCGC TAAGCTGCAT CTTTTTTGTT CTTTCTGCTG TGAAAATAAT TTTGTCGGAA AATGTAACCA 002400
002401 GTGCAATTAT ACTGAAATTT CATATGAAAT GTTAATAAAA TGGATGTGTG ACCAATAAAA TACTTGATGC CAAATTAAAA 002480
002481 A

Predicted Small Protein

Name STX18-AS1_smProtein_2276:2434
Length 52
Molecular weight 5926.2996
Aromaticity 0.115384615385
Instability index 40.0501923077
Isoelectric point 8.85870361328
Runs 7
Runs residual 0.0157540199913
Runs probability 0.0589623236682
Amino acid sequence MLCKRDCLFVFYLLISNTVVPLSCIFFVLSAVKIILSENVTSAIILKFHMKC
Secondary structure LLLLLLEEEEEEEEELLLLLLHHHHHHHHHHHHHHHHHLLHHHHHHHHHHHL
PRMN LLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHHHHHHLLLLLLLLLLLLLLLL
PiMo iiiiiiiiiiiiiiTTTTTTTTTTTTTTTTTTTTTToooooooooooooooo