SAP30L-AS1

From LncRNAWiki
Jump to: navigation, search

Annotated Information

Approved Symbol

SAP30L-AS1

Approved Name

SAP30L antisense RNA 1 (head to head)

Previous Symbols

_

Synonyms

FLJ38109, GALNT10-AS1

Chromosome

5q33.2

RefSeq ID

NR_037897

OMIM ID

_

Ensembl ID

ENSG00000245275

pubmed IDs

12477932

Sequence

>gi|323668272|ref|NR_037897.1| Homo sapiens SAP30L antisense RNA 1 (head to head) (SAP30L-AS1), long non-coding RNA

000001 AAAGTAGAGA AAGTGGAAGA GGAAAGAGTT ACCCCAGCGA GAACCGGGAA CCGGGCTGCA GACTCTCCGG CCCGGGGGAG 000080
000081 GGATGAGTTT CACTCTGGTT GCCCAGGCTG GAGTGCAATG GCGCGATCTC GGCTCACCGC AACCTCTGCC TCCCGGATTC 000160
000161 AAGCGATTCT CCTGCTTCAG CCTCCCGAGT AGCTGGGATT ACAGATATGC TCTAACTTAT TTATCCCCAA AGGACGTGCA 000240
000241 TTTGGGTCAT TTTCAATCTT CTGCTATGGT AAGTAACACT TCAGCAAATA AATCTTTGCT CATCACTGTC TCTCTTATAT 000320
000321 AAACTCCTGG GCATGGAATT TCAGGTCAAA GAATGTGCTT GCTCTGAAAT GTAATGGATT TTGCCAAATT GCTATTCACA 000400
000401 GAAGATATAC CCACTTACAC TGCCCCAAAG CCTACATTTT TCTCACTTTA GTTTGGTCAC ATTGTCCTGG TTGGATACTT 000480
000481 TCTGTCTCCC GTATCTCATA GTTGGAGATA TCCTAACCAT GGCCTCCTGG GGACACTGTG CAGTTTCCTT TCTGCTCATC 000560
000561 CTGCTGCCTC CCCCCCTAAT CCAAACAACC CCTCATATCT GTGTATGTCA GAGGGCTGTC CACACAGCAT CTCATTTGAT 000640
000641 CCTATCTTGT GGGGTAGGAA GGAAAACCGT ATCAGCACAG TCTGGGGTAT GAGGACCAGA GGTGAAACAA CTGGCCCAGG 000720
000721 GTCCTAGGAT GGAAGGAGAG CCTCCTTGCT GAGCACTTTC CCACCATACA CCATTGTCCA AAGATGGCCT CCTAAGTCTG 000800
000801 GGAAGGGTAG TACCAAGGAG GTATATCAGT TGGAAGTGAT GCCACTAACA CACTAACACT TACTGAAAAC ACTGATGTGG 000880
000881 GCCAGAGACT GGGGATATAG AGGTGGACAA AACCTCCTCC CTGCCTCCAG GGAGCATGCA GAGATGGGAG TGCAATGTGG 000960
000961 GGTAGTTCCT AGGCAGCATG GGGAGCCATC TATATAAGCT GAGATTGGAA GGGTGAATGA GGGTTGGCCA GACTAAGGAA 001040
001041 TGGCATTTCA GGAGTGTACA GTGTGGGCCT GCAGAGAGGG GCTGGCCCGT AAGCCTGGTT CTTACATGCA GTCTTGTCTG 001120
001121 GCTGGGTAAG GTAGACATCT ACGGTTTGCT CTGCCCCACA TCCATTCTCC CTTCTGGGCA CAGCACCTGG ACTTTCCTTT 001200
001201 GGGTAACTAG CCCATCCCCA CCTTCCTGCA GTCACAGGGC ATGTGACTGC AGGTGACCAA TTGCAGTATT GTTCAGGGAT 001280
001281 GGGCATGGGG CCAGCAGGCC AATGAGACTC AACCTGGGGA CTTGTACAAG ATGATGGGAA AAACACTCTC CTTCCATGGG 001360
001361 CTGCTGAGGA TCTCCATGAG AAAAAGCCCA CCTGAGAGGG AAGCCAACTC AGATGAAATA GGGACTAGGC ATTGAGAGAG 001440
001441 ACCTAGCCCG AGTGAGATGA CTGAGTCCCT GCATCCAGCC CGGCCTTAGG GTCTACCCTG GAATTTCAGT TATGTGAGCC 001520
001521 TATCAATTCT GGTTTTTGCT TAAATCAGAT TGACTAAGGT TTTGGTTATC TGTAAGCAAG AATCCAGACT AATGCAATGG 001600
001601 GATAAGAGGA AAAGGGGAAA GGAGAGAGCA GTAGGGCCAG CTCATGAACC TAGCTGGAGC TAGGCTATGG AGTTAAAGAC 001680
001681 TTGTCCAACC ACTAGAACTA GGAAGATTCT GACTTCCACG TGAGAACTTT GCTCTGCTGA GAGAGACAGA CAGAGAAGGA 001760
001761 GGGAGGGAAA GGGAAAGTCA ATGACTTTTC TAGAAATTTC AGAGCTGTTG GGACACTTTT TGGGGATTTT CTCATCAGGA 001840
001841 TAGAGAATCC GGTCTGGAAT CAGCCCTCAG CCCTGAAGGT ACGTGTTGAT TGATCTTAAT TTCTGAAAAT ACACTCATGC 001920
001921 CTTTCAGACC AGGCTTCTCT CTGTCACCAA GAAAAGGGAT CTTAGCAGAG ATGAATCAGA GGGAATTCGG TCCTTCGTAA 002000
002001 ATGCCAGCTC TGGCTGAAAG AGAACACCTG CATTCCAGCA GGGCGCTGCC AGGGATGAAT GGGCTCACCT GTTCCCCTCA 002080
002081 GCCCTGCAGG CAGTCTTTCC ACAGGGTCCT GGGAGACAGT GCACTGGCAG ATGGGCTGTT GCTGGCTCCA GAAACTCTCC 002160
002161 TTTTCCAAGC CAGGAGAGAG AAAGCCCAGG GAGAAAAGTC TCCCTTCCGG ACCTCAGGAG CCTCCTCATT ACACTGTCTC 002240
002241 ATTTCCTCTG GAGAGTGACG GACATAATTG GATCAAATGG AAATGTAAGC CAGCCTCCTT CCCCCTCCCG GATGAGATAC 002320
002321 TTCCAATATG GCTTCATTAC CAAGTCTATT GTAAATAACT GTGGAGAAAA ATGCCATTTG TTCTGCCATA ATTGCCTGAT 002400
002401 GAGCATCAGT AGATGGGTCT TTGAAACACA TAGAATGAAA TCATTTTGGG CTGGTTTAGA AATTCCTTTG TGCAAATCTT 002480
002481 TCTCCATTCA CTGTTCTCCA TGGTGGGGGT TCTGAAGAGG GTCTTCTAGA GCAAGGAGCC AGTTAGGAGC TTGGAGGCTG 002560
002561 ATTCTGGCCA GGGACACACT TACTTGGAGT ATTCAGCCAA TATTTGTTAA CTGCTGTCAA CTAAAGAAAA AAAACGAAGC 002640
002641 TTTTAAAGAA TTAAAGTTAG TTTTATTTAG AAGTCTTCTT GAGGATTATA GACCAAGGCC TGTAGCCTGG GAGGAGGCTT 002720
002721 TTAGAAAGGT TCTCTCAGAC TCCTCCAACG TAGTATTTTA GTTTATACAT AGGTGGTGAA GATTTAGTAT GTGAAAAATT 002800
002801 ACATCAAGGT TTGGGTGTTA GAGTACATCT GGTTATAGAT TACAGAAACA TAGTCACTAT TCTTGTCGGG TGTTATTTTA 002880
002881 TGAGTAGAGA AAGGCGAGGA CTAGGGTCAT TTATCTTTGA TGGAATTAGT GACTCAGGCG AGAGACATGG GGGGCCATGC 002960
002961 GTTCTATCCT GTTTTGCCTT TAAAACATTT TTCCAGAGAG CTGCACAGTG TCCCGGAGTC AGGGGCTTTG TGAAATTCTC 003040
003041 CCAGCAAAGG GAAATGGGCA AACACGGCCT CTTACATTTG CCACTTTGTT TCACGAAGTT TTTGGTCATA AATTGTTTGG 003120
003121 TTGTGTTGGT AAGAATTAAT GTTGATTGCC ATCTGTAGTT AGAAGGGCTC TTGTTTAGGA AGGTTGGTAA TTTTTAGTTG 003200
003201 TAGTTGTATC AGACCTAGTG TGTTTTTTAG CCTTTTCTTG GAAAATATGT TTTGGACTGA GTTTAGTTCT CATTAGTAGG 003280
003281 ATGCAGGGGG TTTTTGATGG TGTCTTTTTT TTGTATTTAA TACAATATTT TAATAGGATT ATTATGAGGA TATTATAGAT 003360
003361 TCTATACAGT AATACAGACT TCATAGTAAT AAAGTCTGTT GTAGACTGGA AAAAATATGA TATTTAATAA AATTGGAATA 003440
003441 TATATTTGTA AAAAAAAAAA AAAAAAAAAA AAAAAAAAAA AAAAAAA

Predicted Small Protein

Name SAP30L-AS1_smProtein_2879:3157
Length 92
Molecular weight 10332.0792
Aromaticity 0.108695652174
Instability index 35.6347826087
Isoelectric point 9.37493896484
Runs 14
Runs residual 0.0169690334689
Runs probability 0.0350013879426
Amino acid sequence MSRERRGLGSFIFDGISDSGERHGGPCVLSCFAFKTFFQRAAQCPGVRGFVKFSQQREMG
KHGLLHLPLCFTKFLVINCLVVLVRINVDCHL
Secondary structure LLLLLLLLLLEEELLLLLLLLLLLLLEEEEHHHHHHHHHHHHLLLLLLEEEEELLHHHLL
LLLEEELLLEEEEEEEEEEEEEEEEEEEELLL
PRMN LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
LLLLLLLLHHHHHHHHHHHHHHHHHHLLLLLL
PiMo iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiTTTTTTTTTTTTTTTTTToooooo