LINC01560

From LncRNAWiki
Jump to: navigation, search

Annotated Information

Approved Symbol

LINC01560

Approved Name

long intergenic non-protein coding RNA 1560

Previous Symbols

CXorf24

Synonyms

_

Chromosome

Xp11.23

RefSeq ID

NR_126059

OMIM ID

_

Ensembl ID

ENSG00000196741

pubmed IDs

12477932

Sequence

>gi|689972625|ref|NR_126059.1| Homo sapiens long intergenic non-protein coding RNA 1560 (LINC01560), long non-coding RNA

000001 TTGGAAGGGC GGTCATTTCT GCCGCGGAGC CCGCGGTCCC CTACTCGATA TACCCCTGTG GGATTTTCCA GTGGCCGAGG 000080
000081 CACTGGGCCA TGGAATGTAC CACCAGGCTT CTCCCCTCCG CCGCAGCCTC TAGGAGTTAG TCACCTCCGA GGCCCCGGCG 000160
000161 GGCGAGGCGC TTTGCCTCTT CCGCCCTCAG GGTGCCCTCG GCCTCAGGCC GTCCCTACCG GGGAGCCTCC GCCTCTTTAA 000240
000241 ATATCGCCCA GCCCCCACCC CCAGGAGCAG GTCGCGAGAC GCACCCGCCC CCGCCCCTGC CGCCGCACTG CTCTGTGGGA 000320
000321 CGCGGCGACC CCTCTCCCGC GGCGGCCGGG ACCCCGCGCC CACCGCGTCT GGAGCCCACC TGGCGGCCCC ACTGGCTACA 000400
000401 TTTCCGACCT GGACCCCGGC CGGCTGCGGG AAACACTCGG CGTCTCGGCT GTCACCGAAC CTGTGCAGTT GCCGCGGGGG 000480
000481 GAGTCGTGCG TGTCAGATTT AGGCCAGGAA GCGGAAGTCG CCAGCAGCGA GAGTTTAACC TCTGTGGGCG CAGAGGGTTG 000560
000561 CGGGGATTCA GCGCCCGGGA CCGTGGATCT GTGCAGGGAG TCATAGGTGT GTGTGACATC AGTGGTGGAA CATTTTGGCT 000640
000641 CGTTTTCACA ATTCAGTCAT TATCCTTTCT GCTTTCCTCC TGGAAGCATT AAGGTTGAAG TTTTCTTCTA AAGATCAAAG 000720
000721 TTTTGATTTG TTATATTAGT TCGGATTTGT TTGATTTTTG TTTGTGTTCG GTTTCAAGTG CTGATTTGTA ACTTTTCTCC 000800
000801 CCCCCCCACA CACGCCTTTT GACCCCTGAA TTATTTAAAA GTCCATTGTT GGAGTGGCAA ACATCCTCCG AGACTCAAAG 000880
000881 GGCAAGGCCA TGGGCGCTTT ATTCCGGCTG CTGCTCCAGG AACGTGGGAA AGCAGCGGAG TTTTATTCTA GGGGAAGGAA 000960
000961 ACAAAGGCGG CCGAGTGCCA GCTGCACGTT TGGTGGGATT TGGTCATCAG GGGTGGACAT GCTGCCCAAT GGAGCTGTCG 001040
001041 GCAGTTTGAC CCAGCTTGGT CCGTCGCGTC CTGTTCTAGG AATCGATTAT TCAAAGAAGG AATTTAGAGG GACTGCAGAA 001120
001121 AATGTTACAG GTCTTAACAC CATTTTGCAT TTCCGCAAAC GAACAAGAAG TTAATCCCTG TGTTAGTGAT TTCTAAGCCC 001200
001201 ATTTGCCTTG TGGCCCAAGA ACGTTGAGTT TGAAATTTGA TGAAACTTGC CTTAAGGCTC AAGTACGAGG CCAGCTTTCA 001280
001281 AAAATGGTTT TGTGCCTTGA TTGAAAACAC TGTATCTTCT AGTTGTTGGA TTTATCGTAC TCTGCGGCTC TATTGGTTCA 001360
001361 AGCTTGTGCG TTGGGCCTTT TAAAATGTGT GTTTCCTGAT AATTCCCTTC AGCTTGTCAA CTGGGGGTGA TGTGGCAGGG 001440
001441 AGAAAGAGAG AGAGGAGAGA GAGAGACTGT ACTGGCAGGT TTTCCTTGTG CTATTCAATT TTTGCTTCCT ATGTTTTGAA 001520
001521 GTTTTATTAT TAACTGCAGG TTTCATTACT GAATAGATAT AGCCAAATTC CTTCCCCCAA AAGATTATAA AGTTTCCTAG 001600
001601 TCCTACCAGC AAAATCATTA AGTTCATTAA GGCAAATCCC CTCCAGCGCT GGATGTTGAT GCTGTCTTTA ATTTTGTATT 001680
001681 TTTCTGACTA CTTTGTGCAA TTGAGGATTG TTTTGGTCTA TTGGCCATTT GGCTTTTCTC TTTTGCAAAT GTTCATATCC 001760
001761 TTTGTCCAGT TTTCTTTAGG GTGATTTTTC CTTTTCGTAT CAATTTGTAA ACAGTGTACA AATTACATTG TACATTAGGG 001840
001841 ATATTAACAG TCTGTCAGTT ACACTGTACA TTAGGGATAT TACATTAGAG ATATTAACAT CTTTGTCCAT TAAGGATATT 001920
001921 AACCATCTGT CAGTTACATT GCAGTATTTT TCCCTAAACT CTTTTTGTCT TTTGCATTTT ATGTTTTTTT AAATGTGCAA 002000
002001 TTAGAAAAAT TTTATATGGG CTGGGCACAG TAATCCCAGC ACCCATCTCT ACTAAAAATA AAAAAAAAAA TAGCCAGGCG 002080
002081 TGGTATCTCA ACTAAAAAAA AAAAAAAAAA TTGCCGGGCA TGGTGTTGGG CGCTTGTAAT CCCAGCTACT CGGGAGGTTG 002160
002161 AGGCAGGAGA ATCGCTTGAA CTTGGGAAGT GGAGATTGCA GTGAGCTGAG CTCGGGCCAC TGCACTCCAG CCTGGGTGAT 002240
002241 AGAGCAAGAC TTCATCTCAA AAAAAAAAAA GAAAGAAAAA TTGTATGTGT AATATGTAAC TAGTGAAATG TAGCCTCTGA 002320
002321 TCAGATATGT CTAAACTTTC TTTTATGGCT TTTGTATATC CCATCTTGCC TAGTTTCACT TCCCTATTCC AGATAGAAAG 002400
002401 ATAATCTTAA CATGTATTTC AGTGTTTTTA TTGCTTTAAT TTTTTCTACT TTAATCTAGT TGGAATTTAC TCTGGTATAT 002480
002481 GGTATGAAAT CAAGATCAAG CTTGAACAAG AAAAAAAAAA AAAAAAAA

Predicted Small Protein

Name LINC01560_smProtein_1652:1783
Length 43
Molecular weight 5174.2296
Aromaticity 0.255813953488
Instability index 22.8930232558
Isoelectric point 5.58697509766
Runs 6
Runs residual 0.0177684870656
Runs probability 0.018680445151
Amino acid sequence MLMLSLILYFSDYFVQLRIVLVYWPFGFSLLQMFISFVQFSLG
Secondary structure LHHHHHHHHHHHHHHHEEEEEEEELHHHHHHHHHHHHHHHHLL
PRMN LLLHHHHHHHHHHHHHHHHHHHHHHHHHLLLLLLLLLLLLLLL
PiMo i??????????????????????????????????????????