LINC00623

From LncRNAWiki
Jump to: navigation, search

Annotated Information

Approved Symbol

LINC00623

Approved Name

long intergenic non-protein coding RNA 623

Previous Symbols

_

Synonyms

_

Chromosome

1q21.1

RefSeq ID

NR_024584

OMIM ID

_

Ensembl ID

ENSG00000226067

pubmed IDs

24946557

Sequence

>gi|609881073|ref|NR_024584.2| Homo sapiens long intergenic non-protein coding RNA 623 (LINC00623), transcript variant 4, long non-coding RNA

000001 GGTTTCCATC CTTTAGGAAG ACCCTGGAAC GTGCCAGTTG ATTCTGACAA TTTCTCATGA ACAGAAACAC CTAGGAAGGG 000080
000081 AGAACTGGAT TTATTTAATG GGGATGTGTT CAAGGCAAGA CCGAATTCAG AAGGATATCG ACGTCGTGAT CCAGAAGTCC 000160
000161 AGAGCTGAGG ACTGCCTGTT TGCAGGGCCC GCCTGGCAGG ACGACTGAGC AAGTTCTTGG AAAACCAGAG ATATTAGAGC 000240
000241 GGTGAATCGC GCTGGTCACG TTGGACACCT GCGCGTTAGG AGATTCTGGA GCCAGAGGGA GAGACCCCAG AAACGCCCCG 000320
000321 GTCGGCGACC CAGCCCGAGA CGCCTGGGGT CCCAAGGGAA GCTGAACGCC CGGTGGGCTC CCGGGATGGT TCTTCCGGTT 000400
000401 CTTTGTGCCG CCTTCACCCA GTGAAGGAGC CTGTATCCAC CCTGCCCAGT CGCTGTTGGG CTGCTGCGGA GCTTCCGCTG 000480
000481 CCATCTTCGG ATCCTGTGTT CCGCCCGGGG CTCCACCAGG GCAGGGATGG TGCAGAATGG GGAAATGGAG AGAGAACCTG 000560
000561 AAAGAGCCCC AAACTCGAGG ACCTATTGCT CCCCAAGAAT AACATCTTCC AGAACTAGAC AGAAAACTAG GCGTCTGGGA 000640
000641 ACCCTGAAAT CCTTGGAGGA GTAGATCATC ATGACCCTCT GTGTTCCTTT TGGCAAATGA CTTGCTTCCA TTGTTTGTTT 000720
000721 GTTCAATTGT CTGTTTGTTA AATAAATAAA ACCCTTTTTA TGTATCTTTA AAATTACATT GGTTCTATTA TTTTATGATT 000800
000801 ACAAACGATG CTGCAGTCAT CATTCTTGTA CACTTCTCAT TGGCCACTGG TGTATTTCTA TAGGGTGGAG GCCTGGAGAG 000880
000881 CAGTTGTTCC AGCATAGTGT TTACATAGCT TTTATTTAAT TCCGTTTTCT TTCCTTTGTT GCTTTATTAG CTATAACCCT 000960
000961 TCTCTTATTT CAGTGGCAGC TTTAGGGTTT CTGGGATACA TCTTTAATTT ATCACATTCT GCTTTCAAGT GTAATTATAC 001040
001041 CTCCCTTTCT GGCCTTTATC CTAGTGTTAC GTATTTTTAC TTTATGCATT ATAAGTTTTG TGATTATCAT TACCTTCATT 001120
001121 TATTATGTCA AATATTTTTA AAAAGATTTA AATTATAAGA AAATGTGTAG TACATGCTTT CTAAATGCCA TTTCCAATAT 001200
001201 TTGTTTTTGT ATAGGTCCAG ATTTTTATCT GGGATCCTTT TGCTTCTGCC TGGAGGACTC TTAAGATTTC TTGTAGCGTG 001280
001281 GGTTGGTGAA TTCTTTTAGT TTTTGTATGT TTTTCAATGT CCTTATTTCA CTCACAGTTT TGAAATTTTA TTTTTGCATA 001360
001361 GAATTCTAGG TTAATTTTTT TCTCTAGTAC TTTAAAAATG TTGCCATTTA TGAAGCATTG CCATTTAAAG TATCATCTTT 001440
001441 CATGTGCTTG TGAAAATGGC ATAAAGCCGG TTTCTTGTGC TGGTTATGTA ATTTTCAGAA TGTGTATTTA AATTTAAAAT 001520
001521 ATTAAATTTT CCTAAAAAAC TAAAAATATT AATCATGAAT GTCCTAGATT CATCTTAAAT TCCACCAACA GTGCACTTAA 001600
001601 AATGTGCCCA ACCTGAGGGT CAAACCTACC TGCTGACATG TAATTTGTGT TTGTGAGACA TTCTCAACAG CATTTGCTTT 001680
001681 CCCCAGCTGA GTGATCTTCC TCACATCTGA ATGTCTTCAG TGCAAAAGGA AATGTTTTTC TTCGCAAAAA TACTTTCAAA 001760
001761 TACTCTTACT TCAAGGAAGT GCATTAAAAA CAAACTTCTC ATTTGCATCC CTGGAATTCA AAGCCCTAAT CAAGTGCTTC 001840
001841 AGGATCAAGA GCTAAACAGG GGAGGACAAA GCGTGGCTTC TTCACTAGGA GTCAAGCCAA AGTCAACTGG TTTGATCGCC 001920
001921 AACGTAGATC GGAACTCGGT TCACCAGCGA CCTGAGGACC CGGCCCAGAA GAGGGAGTGT CTCTTCATGG TGCCTTCAGA 002000
002001 TAGAAAATCT CCTAGGATTT CTTTCTTTCC CTTTGATCTA CTTCCAACTC TCCCTTTCTA TTTCTTCAAG ACCTTTTTCG 002080
002081 GATCCCTACT GCGAAGGACC TAAGGGGCCG GTGCCCTTCC CCACTGGTCC CTCCCTGCCT GGTGTCTTAG GAGCCCAAGC 002160
002161 TCACCTGGAA CATTACTGCC CGCCGGAGAC AGCGAGAGGA CCAAGGAGCG CGGCGGTGCG GTGGGAACCA CAGCGTCACC 002240
002241 GCTCACCTGC GCCTCGTGGG CTCCTAGAAA ATTGAATAAA TGCCCCCTGA AGCTTCTCTG CAGGTCACAC GGAAGAGGAG 002320
002321 GGTGGCTGCC GACACGCGGG AGAAGCTTCA AGAAGCGTCG GGAGGACCTA CCTGGTCCTG CCCCTGGGCC TTGAAGACAG 002400
002401 GCCTGGCCAG GCTGATTTGG TCCGGTAGTC TCAAAGAAAA TGTTCAAGGG TGGCCCAAAC CTCCACCCCA AGATTAAGGC 002480
002481 TCTTAAATGT CTGACGGTTT TGAGACTCGT CAGTAGAATC AATCCCGCCT GTATCAGGAG ACTCCTTTGC CAAAATTCAA 002560
002561 AGACCAAGAA AGAGAAAGAT TGGGCAGGTT AAAGTCTGTA ATTAACCAAA CAGGAGACAG AATTTTTCTG AGAAATTGTA 002640
002641 TGTGTGCTGT GAGAAAAAGA CTAGCCTCAA GGAGAATCTG TTCTTTTGGC TTAATTGTAG GAAAGAATGG AATTGCCACC 002720
002721 AACAATGGTA CGTTGAAACG GCAGGTGCAT CAGGCTGTAG ATGTGAAGGA ATTAAAAATA TTTTACCCCA AAATACATTT 002800
002801 CTTTGACATA TTTTGAGATG TCTGTTCAGA AAGCCAGCTG CAGAAGTAGC CCTGCAAAGT TGTCTTTCGT TGGGGAGATT 002880
002881 TGCATCTGTA GGGAATCTGC ATTGATGCAG CCAAGTCTTT CCTTGCCCAG ATCTAGGAAA GATTAACTGA GAGTCTGACA 002960
002961 GCTGTAAAGG TCTGAAAGAA ACTTTCAGAG CTTATTCTTT CTGAGAGCTG CTGCCTGTAA GGTTTCATTT ACATATTAAG 003040
003041 ATCACCTTTG CTAGCCAGGC CTCCTCTTCT CTCCCTCCCA TAACCTGTCT TGCCCACAAT AAATGGATAT ACCTCTGACT 003120
003121 CTAA

Predicted Small Protein

Name LINC00623_smProtein_2279:2476
Length 65
Molecular weight 7210.1778
Aromaticity 0.0615384615385
Instability index 55.1553846154
Isoelectric point 9.85565185547
Runs 8
Runs residual 0.0272115384615
Runs probability 0.0445040628865
Amino acid sequence MPPEASLQVTRKRRVAADTREKLQEASGGPTWSCPWALKTGLARLIWSGSLKENVQGWPK
PPPQD
Secondary structure LLLLLLLLLLHHHHHHHHHHHHHHHHLLLLLLLLHHHHHHHHHHEEEELLHHHHLLLLLL
LLLLL
PRMN -
PiMo -