EWSAT1

From LncRNAWiki
Jump to: navigation, search

Annotated Information

Approved Symbol

EWSAT1

Approved Name

Ewing sarcoma associated transcript 1

Previous Symbols

TMEM84, NCRNA00277, LINC00277

Synonyms

FLJ33768

Chromosome

15q23

RefSeq ID

NR_026949

OMIM ID

616492

Ensembl ID

ENSG00000212766

pubmed IDs

25401475

Sequence

>gi|223972678|ref|NR_026949.1| Homo sapiens Ewing sarcoma associated transcript 1 (EWSAT1), long non-coding RNA

000001 AGACCATTTC CTACAACTAT GGCTTGTCTG AGTCCTGAGC CAGCAGAGCT CAGGCCACAG CACCTGCACC CGTTTTCTGC 000080
000081 TGCTGCACAC AAGGGCTCTG TGCATTCCGC ATCCAGGTGT GCCCCTCCTC TTCTGGAGGA TTCTTTTTCA GGCTGTCCCA 000160
000161 GAGACTTTGC AGCACAGCAT CCTTGCTCTA TTTCTTCCTG CAACATCTCT GCTGAAGCTC TATTGCTTTT GGCAACTCTT 000240
000241 CCGTCTATTT TGTGGTTTAG GTGTCTCCTA CTTTTACTAA AAATGGAATT TGTGTTTTTA TCGCTCAAGT CCTTTTTGCT 000320
000321 TTTGGATTAC TTCCAGAAAA TGAAGGGAGG GTTACTAACT TTATGCCATC TTCAAACCAG AAGATCTTAG ATTAGTAAGA 000400
000401 TCATGTTGGC CATGGCATGG AGAATGGGCT GGAGGTGGAG AGACTGGAGG TTGGAAGTCC AGTTAGGAGA TTGCTCCTGC 000480
000481 GCTGGGGAGT TGGTGTTAGG ACAGAAGATC CAAGACGCGT TTCAGAGAGC CCCTCTTCTT GGGCCTGCGA TTCCTCACCT 000560
000561 GGAAGGGAGA AGAGTGGACT TCCTGCCTAG AGAACACCTT GGTAAACTCT TTGTGGTTCC TGTCATGAGA AGGTGTGCAG 000640
000641 CTTAGGGAAA AAGCCTGTGA GCTCTGGAAT CAGATGGAAC TGGATATGAA TTTCCATTTA GTGCTTGTTG GATTAAATGT 000720
000721 GATGCTACTT CTCCCAGCCG AAAGAATAAA ACTGGTAAGA GGAAGGGAAA TGCAGCCTCA GTAAGGAGGC CTCCATTCTG 000800
000801 GAAGGGCTTC CCAGGCCCAG AGAAGGGAGA AAGTAATTTG GAACCACCCA AGTATTGGTG ATGCCAGGCC TCACCCTACC 000880
000881 CTGGGGATAT TTGAATCTCA AAAAGGGAGC ATGGGAATCT GACAAAGCAC TTGCATGTAT AAAGAACTCC TCCAAATCAA 000960
000961 CAAGGCAAAA ACCTCATTAG ATACATAGGC AAAAACCTCA GAAGAGCCAC ATCACAAAGG AGCACCTCCA AATGGCCAAG 001040
001041 AAGCATATGA AAATATGTTC AATCTCATTA GCCAACAGGG AATTCAAATT AGAACTACAC CAGGATGGCT GAAAGTGCAA 001120
001121 AGACTGACAA TATCAAGGGC TGGTGGGGAT GCAGAACAAC TGGAACTCTC CTATGCACTG CGGAAGGGGT AAATTAATAC 001200
001201 CGCCCCTTTG GAAGAACAGT TTAGAAGCAT CACTAAAGCT GAATATATTC ATGCCTACTC CGGAAATCCT GAGCCCAGGT 001280
001281 ATATATCTAA CAGAAGTTTG TTTATAAAGG CACCAAAAGT CAATTACACA AGATACAAGA ATGTTCATAG TAGAGCCGTT 001360
001361 TGTATTAGTC ATAAACTGGA AACCACCCAA ATGCCCATCA GTGTGGCTCC CTTTGAAGAA CTGCCTTGGG GTTCATGTTG 001440
001441 CAGCATCAAA CAGGGATGGA AGATGCATCT TGCTTTAGCA GCAGGAGCCT GGAAAGCAGC TGAAGCCCTG GAGGGTGCCT 001520
001521 GGCACACAGA ATCTTGTGCT GAGCCCGGAG CACAATGGGA GCGGGCTGGC GGGGTGGGTT CACAGCTGGA CTGGGAGCAG 001600
001601 CAGACATACA GGCCGTAGGC ACAGACATAT AAAGACAGTC ATGCAGATTG CAGGATGCCT GAGAGCACAG ACTCTCACAT 001680
001681 GCACAAATAC GTGCATGATC GCCAGTGTGC ATCCAGACAG CCCCACATGC ATGCACACGC ATGCACACAT GTGATGTGTA 001760
001761 CATAGATGGA CACATGTCTA TGCCCACAAA CACTGCAGAG ACACAGAAGT GTCTGGCAAG GAACACTATT TTGTCCTCAA 001840
001841 TTTTCTGCCA GTGAGAGTCT ACTGACTCCA TCTCTGAAAT GTCTCTACTT ATTGTCCCTC TTCTCCACCT GCACCACATC 001920
001921 CCTAGTCCCT GAAACTCCCA CCGAGACCCC TGGGCAATAG CAAAGTCTGC ACAGGATTCC TGCTCCGCCT CTACCCCACC 002000
002001 CTTAAGCCCA TCCTACATGC AAGAGCAGGA GTTATCTGGG TATCAAGCAA ATCTGACCAC ATCACCTCCC CACTGCTTAA 002080
002081 AACCCTTTCC TACAGGATGA AGTTGAAATC ACTTGACATC CCATATAAGG CCCTTGACTG TCTGGCATCA GCCATAGTCT 002160
002161 GGCCTCAGGC CCTGGCATGG AGTCCCCTGG ACTCAGTGCT CTGGCTGAGG GCCTCCAGGA TGAAGATACC CTGTGCAAAG 002240
002241 CCTCACACTT TTGCTGTTGC TGGGCTCACT GTGTGAAATT CCCTCCTCCC TCCTTCCACC TTCCCTATGC TGAACTGCCA 002320
002321 CTCCTCCATC CTCCATGGCC AGCTAAGCCA ACACCTCCCC ACTTCCTCCT GACAACCCAG GCACAGCCAC TGACCTGTCC 002400
002401 CATGGCTGTC ACAGCCCTTT CTTGGGCTCT CAATGGTATC ATTGTCACCT GTGTGCTCAT GAGCCTCTGC CACTCAACTC 002480
002481 CAAGCACATC AAATAAAGAG CTCAAAACAT ATCGGATACT CAACAAA

Predicted Small Protein

Name EWSAT1_smProtein_2096:2275
Length 59
Molecular weight 6493.7713
Aromaticity 0.0847457627119
Instability index 31.2305084746
Isoelectric point 9.51068115234
Runs 9
Runs residual 0.0080858342404
Runs probability 0.0575869987634
Amino acid sequence MKLKSLDIPYKALDCLASAIVWPQALAWSPLDSVLWLRASRMKIPCAKPHTFAVAGLTV
Secondary structure LLLLLLLLLHHHHHHHHHHHHHHHHHHLLLLLHHHHHHHHHLLLLLLLLLLEEELLEEL
PRMN LLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHHLLLLLLLLLLLLLLLLLLLLLLL
PiMo ooooooooooooooooooTTTTTTTTTTTTTTTTTTiiiiiiiiiiiiiiiiiiiiiii