ENST00000604849.1

From LncRNAWiki
Jump to: navigation, search

KANTR encoding a functional long non-coding RNA thought to play a role in neurological development or function.

Contents

Annotated Information

Name

This gene is thought to produce a functional long non-coding RNA. Mutation of this locus in mouse causes tremors and spastic movements, suggesting a role for this gene in neurological development or function(HGNC nomenclature).

Spasm[1]

PREVIOUS SYMBOLS & NAMES

LINC01155, "long intergenic non-protein coding RNA 1155".

Function

Mutation of KANTR in mouse causes tremors and spastic movements, which suggests a role in neurological development or function[1].

Labs working on this lncRNA

Department of Stem Cell and Regenerative Biology, Harvard University, Cambridge, United States[1]

References

  1. 1.0 1.1 1.2 Sauvageau M, Goff LA, Lodato S, Bonev B, Groff AF, Gerhardinger C, et al. Multiple knockout mouse models reveal lincRNAs are required for life and brain development[J]. eLife. 2013,2:e01749.

Basic Information

Transcript ID

ENST00000604849.1

Source

Gencode19

Same with

NONHSAT137141,KANTR

Classification

intergenic

Length

1196 nt

Genomic location

chrX+:53123371..53172633

Exon number

3

Exons

53123371..53123466,53171030..53171276,53171781..53172633

Genome context

Sequence
000001 GGGTTCCGTC CAGCGTATCC TTCAGATCTT GCTGTAGGCC TCTGGTGTCT GTGCGCGCGC GGCAGGGGCG GCGGCGGCGA 000080
000081 CGGCCGGAGG TGTACGGTGT AAATCCAAAC CGCTTCCAAC TCAAGGCAAG TAACAGCCCA CGGTGTTCTG GCAGGAAAAC 000160
000161 ATCAGCTAAG AAAGGAAACT GGGTCCTATG GCTTGGACTT TCCAACTCTG ACAGACCGGC AGGACAGAAA CAACTGGTTC 000240
000241 AGGAGCCCTT GCCAGCCTCT AGAGAAATCC CAGAACACTC AGCCCTGATG ACACATTAAT ACCCTGCACA TATTGGAGAC 000320
000321 TGCTGACCAC GCATACTCAC CAACCACCAC TTCTGGCCAC AAATTTCTTT TTGAAGGCTT ATTCCAGTTT TGTGAGGCTA 000400
000401 GCATGAGGTG TATGCATTTG CCAGGGGCAA ATTTATACTG CTGAATTAAC CCATGCAACA AATGCTGCAC ATCTGCTCGC 000480
000481 AGTCCATTTA GAGGCATTTG CGGTAGACAA TGGAGGGGCC AGACTCATCA TACATACCTG ATGGCTAACC CACATGCTTG 000560
000561 CAGTCCATTT AGAGGCATTT GCAGTGGATG ATGGAGGGGC CACATACCTA ATTGCTAATC CACATCTGCT GGAAGGTGGA 000640
000641 CAGTGAGGCC AGGATGGAAC CACCAATCCA CACCGAGTAC TTGTGCTCTG GGGGCATGAT GAACTTGATC TTCATGGTGC 000720
000721 TGGATGCCAG CGTGGTGATG CCAGGGCACA TGGTGGTGCT GCTGGACAGC ACTGTGTTGG CGTACAGGTC TTTGCGGATG 000800
000801 TCCACGTCAC ACTTCATGAT GGAGTTGAAG GTGGTCTTGT GGATGCCGCA GGATTCCATG CCCAAGAAGG AAGGCTGGAA 000880
000881 CAGCACCTGC AGACACCAGA ACCACTTGTT GCCGATGGTG ATGACCTGAC CTGGCCATCA GGCAGCTCAT AGCTCTTCTC 000960
000961 CAGGGAGGAG GAGGATGTGG CAGTGGCCAT CTCCTGCTCG AAGTCCAGGG CGATGTAGCA CACCTTCTCG TTGATGTCGC 001040
001041 GCACAATCTC CTGCTTGGCC GTGATGGTGA AGCTTGGTGA GGATCTTCAT GAGGTAGTTG GTCAGGTCCT GGCCAGCCAG 001120
001121 GTCCAGACGC AGGATGGCGT GGTGGGAGGG CATGGCCCTC GTAGATGGGT ACCATGTAGG TGGCCCTGTC TCCAGA
[back to top]

Predicted Small Protein

Name ENST00000604849.1_smProtein_653:928
Length 92
Molecular weight 10440.4357
Aromaticity 0.0659340659341
Instability index 58.356043956
Isoelectric point 6.48419189453
Runs 16
Runs residual 0.0423534798535
Runs probability 0.0542803833245
Amino acid sequence MEPPIHTEYLCSGGMMNLIFMVLDASVVMPGHMVVLLDSTVLAYRSLRMSTSHFMMELKV
VLWMPQDSMPKKEGWNSTCRHQNHLLPMVMT
Secondary structure LLLLLEEEEELLLLHHHHHHHHHLLEEELLLLEEEEELLHHHHHHHHLLLHHHHHHHHHH
HHEELLLLLLLLLLLLLLLHHHLLLLLLLLL
PRMN LLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHHLLLLLLLLLLLLLLLLLLLLLLLL
LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
PiMo ooooooooooooooooooTTTTTTTTTTTTTTTTTTiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
Personal tools
Namespaces

Variants
Actions
Navigation
About
ScienceWikis
Toolbox