ENST00000511918.1

From LncRNAWiki
Jump to: navigation, search

LUCAT1,a smoke and cancer–associated lncRNA, which regulated by NRF2,is induced by smoke and up-regulated in airways of smokers in many lung cancer cell lines and plays a functional role in mediating protection against cigarette smoke–induced toxicity.

Contents

Annotated Information

Name

SCAL1 expression in CL1-0and CL1-5 cells and in nonsmokers and smokers. [1]

LUCAT1: lung cancer associated transcript 1 (non-protein coding)(HGNC nomenclature)

SCAL1, "smoke and cancer associated lncRNA 1"[1]

Characteristics

SCAL1 siRNA knockdown potentiates smoke-induced toxicity in HBE1 cells.[1]

LUCAT1, a novel long noncoding RNA (lncRNA), which is located in chromosome 5 and encompass four exons and three introns, is induced by cigarette smoke extract (CSE) both in vitro and in vivo and is elevated in numerous lung cancer cell lines[1].

Function

LUCAT1 may be a novel key downstream mediator of NRF2 in regulating the genes responsible for oxidative stress protection, which indicated that LUCAT1 plays a protective role in suppressing smoke-induced toxicity in airway epithelial cells.

Regulation

The expression of SCAL1 is regulated transcriptionally by nuclear factor erythroid 2-related factor (NRF2)[1].

Disease

Lung cancer

Expression

Its expression is NRF2-dependent[1].

siRNA primer
human NRF2 GTAAGAAGCCAGATGTTAAdtdt[1]
KEAP1 GGGCGTGGCTGTCCTCAATdtdt[1]
SCAL1-1 CCCACAAAUAGGAAGAAAAdtdt[1]
SCAL1-2 CAUUUCAGUCACUAAAUAAdtdt[1]
RT-PCR Forward Primer Reverse Primer
SCAL1 5'-ACCAGCTGTCCCTCAGTGTTCT-3' 5'-AGGCCTTTATCCTCGGGTTGCCT-3'[1]
NRF2 5'-ATTGAGCAAGTTTGGGAGGA-3' 5'-AAGACACTGTAACTCAGGAATGGA-3'[1]
β-actin 5'-GCGGGAAATCGTGCGTGACATT-3' 5'-GATGGAGTTGAAGGTAGTTTCGTG-3'[1]

Labs working on this lncRNA

  • Center for Comparative Respiratory Biology and Medicine, Genome and Biomedical Science Facility, and Division of Pulmonary and Critical Care Medicine, School of Medicine, University of California at Davis, Davis, CA 95616, USA.[1]

References

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 Thai P, Statt S, Chen CH, Liang E, Campbell C, Wu R. Characterization of a novel long noncoding RNA, SCAL1, induced by cigarette smoke and elevated in lung cancer cell lines[J]. American journal of respiratory cell and molecular biology. 2013,49(2):204-11.

Basic Information

Transcript ID

ENST00000511918.1

Source

Gencode19

Same with

lnc-ARRDC3-1:5,LUCAT1,SCAL1

Classification

intergenic

Length

828 nt

Genomic location

chr5-:90598846..90610200

Exon number

5

Exons

90598846..90598978,90599690..90599788,90608895..90609046,90609455..90609594,90609897..90610200

Genome context

Sequence
000001 CAATGCCCAG ACCTCCAGAA ACCATGTGTC AAGCTCGGAT TGCCTTAGAC AGGTGCAATT TAAGAACAGC TTTCATCCTC 000080
000081 TTTTCTCTCA TATTGTCACA CTATGTGTTC TGACTTCTGG CTCCTTTCCT CACAAGAAGC TCACCCAGCT GGAACTCTTA 000160
000161 TGGGACCTTG GCACCAGAGA CCACAAATTC CTCTTTGAAG TTTTCTAACA GCAACAATGG TATTTCTGAC TTGGCTTTCT 000240
000241 TGTATTTCTC TCACGTTAAC AAAATTGGTT CAGCATCTAC CATGGGCTAC ATGCTGAGCT ACAGAGTTTC GCTCTGTCGC 000320
000321 CCAGGCTGGA GTGCAGTGGC GCGCGATCTC GGTTCACTGC AAGCTCCACC TCCCGGGTTC ACGCCATTCT CCTGCCTCAG 000400
000401 CCTCCTGAGT AGCTGGGACT ACAGGCGCCC GCCACCACAC CCAGGAATCC AACTTGCTGT TTGCTATCAC ATGTGCTATA 000480
000481 CATGCTGTTG ATGAAACTGC TAAAGGGGCT GAATGTGACT GACGTCTTTG GAAGGATGAG ACTTAGCGTG CCTGTACAGT 000560
000561 TGTGTCCAAA TGCTGTCCTC ATCTCCCAAT GAAAAGGAAC AAAACCCATC AGAAGATGTC AGAAGATAAG GATTTTTGTC 000640
000641 CTGATGCTAC ACTTACCAGC TGTCCCTCAG TGTTCTACTT CTTAAAAAAA GAGAGATGGA TAAACAGAGG CAACCCGAGG 000720
000721 ATAAAGGCCT TGCTCAGTGT CACACATTTC AGTCACTAAA TAAGACACAA TGGATGCCAG TATTCTCATC CCCTCACAAA 000800
000801 TAAAGAGCCT TCAAGCTCTT GCAGTCAA
[back to top]

Predicted Small Protein

Name ENST00000511918.1_smProtein_281:490
Length 70
Molecular weight 7712.9769
Aromaticity 0.130434782609
Instability index 56.4536231884
Isoelectric point 8.63775634766
Runs 9
Runs residual 0.0088965418281
Runs probability 0.0445347308093
Amino acid sequence MGYMLSYRVSLCRPGWSAVARDLGSLQAPPPGFTPFSCLSLLSSWDYRRPPPHPGIQLAV
CYHMCYTCC
Secondary structure LLEEEEEEEELLLLLHHHHHHHHLLLLLLLLLLLLHHHHLLLLLLLLLLLLLLLLEEEEE
EEEEEEEEL
PRMN -
PiMo -
Personal tools
Namespaces

Variants
Actions
Navigation
About
ScienceWikis
Toolbox