ENST00000426869.3

From LncRNAWiki
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000426869.3

Source

Gencode19

Same with

lnc-FAM27L-1:1

Classification

intergenic

Length

682 nt

Genomic location

chr17+:21825297..21826499

Exon number

2

Exons

21825297..21825574,21826096..21826499

Genome context

Sequence
000001 AATGCGCATG CGCAAGGAGA GAGCCGCTTC TCCCCATCAC AGCGATTCCC AGGGTTGTCG TAGAAACCAC TCCCTGAGGC 000080
000081 TTCGCAAAGC AGGAGCCCTC CGTAGCAGGG CTTCGGTGTC GGGGCTCCGA GGCTCCGGCC TGACTTCTCC ACGGGGTACA 000160
000161 CAGGAACGTC TCCGGACGCC AGGACCTGAA ATGGGCCGAC TAGGATGACG AAACCACAGG CAGAGTCCGG GGAAGCAGCG 000240
000241 CGGCATCCCA TCTTCAGGCC TGCCCGGAGG GTGTTCGGGA TCAAGATGAC CACACTCCAG CCAAGGATAA AAGCCCCACA 000320
000321 GGAGCTCACT GTCCTGCAGG AGAGGAGCAG GCCCACGTCC AAGAAGATGG CTGTATGTTT TCACGGCTCT TCTCTGAGAA 000400
000401 GTGAAGCCAC ACCACGATAC AGTCTTGAAG AGGAAGCCAG GAATGGGAGA TGGCAACAAG CCCTGTCATG GTGGCCTCTC 000480
000481 TGAACAAGTT ACCCTTTTGG CACCCCTCCC CTTATGCCCG TGGCGGTGGC ACAGTGCTGT ATCCTGCCTG GGCTCTGGCC 000560
000561 CCTGCTCTGT CCTCCCTCTT ACTCTGTCTC CCTTGTTTCT GAGGGGCCTA GATGCTTCTA GGTCTGGCTG AATGTCTTCA 000640
000641 AAAAAGATCA CTTCCCAGTC CATCAGGGAG ACAGTTGGTG GA
[back to top]

Predicted Small Protein

Name ENST00000426869.3_smProtein_449:601
Length 51
Molecular weight 5317.3181
Aromaticity 0.12
Instability index 79.792
Isoelectric point 8.84185791016
Runs 6
Runs residual 0.0446783625731
Runs probability 0.0389507154212
Amino acid sequence MATSPVMVASLNKLPFWHPSPYARGGGTVLYPAWALAPALSSLLLCLPCF
Secondary structure LLLLHHHHHHHLLLLLLLLLLLLLLLLEEHHHHHHHHHHHHHHHHHLLLL
PRMN LLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHHLLL
PiMo iiiiiiiiiiiiiiiiiiiiiiiiiiiiiTTTTTTTTTTTTTTTTTTooo