ENST00000414769.1

From LncRNAWiki
Jump to: navigation, search
Please cite: Chunlei Yu (2016) lncRNA: "ENST00000414769.1" in LncRNAWiki, available at http://lncrna.big.ac.cn/index.php?title=ENST00000414769.1&oldid=1272309 (Last update: Jul 01, 2016). [See details]

MIR503HG, a lncRNA which is likely originated at least 370 Myr ago in the tetrapod ancestor, may functions like H19 by promoting miRNA transcription, preferentially in the placenta and in an imprinted manner.

Contents

Annotated Information

Name

MIR503HG: MIR503 host gene(HGNC nomenclature)

"H19 X-linked co-expressed lncRNA", H19X, MGC16121[1]

Characteristics

Expression pattern for an X-linked H19 co-expressed lncRNA (H19X, identified as ENSG00000223749 in the Ensembl database), in five tetrapod species.[1]

MIG503HG could potentially promote the transcription of between 2 and 7 miRNAs in different species, such as Human,mouse,Opossum,platyous,xenopus,. This lncRNA (that we name H19X, for H19 X-linked co-expressed lncRNA) is ikely originated at least 370 Myr ago, in the tetrapod ancestor[1].

Fuction

H19X is a neighbour of Rsx, the lncRNA that drives imprinted X-inactivation in marsupials, suggesting that H19X may itself be imprinted. These results suggest that H19X may function like H19, by promoting miRNA transcription, preferentially in the placenta and in an imprinted manner[1].

Expression

Expression pattern appears to have dramatically shifted during evolution, from an ancestral testes-predominant pattern to preferential expression in the chorioallantoic placenta of eutherians[1].

Disease

choriocarcinoma

Evolution

Expression pattern appears to have dramatically shifted during evolution, from an ancestral testes-predominant pattern to preferential expression in the chorioallantoic placenta of eutherians[1].

Labs working on this lncRNA

  • Center for Integrative Genomics, University of Lausanne, 1015 Lausanne, Switzerland[1].

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Necsulea A, Soumillon M, Warnefors M, Liechti A, Daish T, Zeller U, et al. The evolution of lncRNA repertoires and expression patterns in tetrapods[J]. Nature. 2014,505(7485):635-40.

Basic Information

Transcript ID

ENST00000414769.1

Source

Gencode19

Same with

lnc-PLAC1-1:2, MIG403HG, H19X, MGC16121

Classification

intergenic

Length

720 nt

Genomic location

chrX-:133677473..133680660

Exon number

3

Exons

133677473..133678029,133678744..133678827,133680582..133680660

Genome context

Sequence
000001 GAAGGTAGAA GGTGGGGTCT GCCGGACGCG TGTTCCTGCC ACCAGGTGCC CGCTCCCCGC GAGGCCGGCT CAGGAGCAGA 000080
000081 AGGAAGCCCG GTGCCAGCCA GCCTTCCTGA AAGACCAAGC CCGCGCCATC CGGCTTCCTC CAGTGGACGC CTGCAGGACC 000160
000161 CAGGAATGTT TTTCTTGAAG GCATCCAGCA TCTCCAGTTA GCAGTACTGA TTTTTTTTCC CCCCAACAAA GGAACACTAC 000240
000241 ATCAACACTG TTGGCGGGGA CCTGGACACA GAAGACTCCT GTTTCAAGAA AATACAATCA TCTCTCAAAG GCTGTAATTT 000320
000321 ATATGCATTT TAAAACTCTA GGCATTGAAA ACCACCCAAG TGTCCCAAAT AGAAGGGTAA TATATAATCA ATCACTCAGT 000400
000401 GTAATATTAT ACATCCTTTA AAAATGTTAT TGGGAAATGT TTTATGATCT GTAAGTCCAA GGAATCCTCT CCCACCATTT 000480
000481 CTTTCCCCCC GCTGTTCCCC CATACCCACA CTTCTTTGTT CCAATTGGCA TGTAAATTTG GTTTTCCCGC CAAATGAGTC 000560
000561 AGTCATGATG GGAACCTCAA CTGATTTGAA CAGATGTGTG TCAATGTTAC TTGGAAAACT AGATGTCAAT AACCAGGGTC 000640
000641 ACAGAAAAAG GCAGTGGTCA CAACTCTGTA AAAATGTATG CATGCACACA GACAAGAACT AAAGTGGAAC CCCACACAGG 000720
[back to top]

Predicted Small Protein

Name ENST00000414769.1_smProtein_443:556
Length 38
Molecular weight 4124.8464
Aromaticity 0.135135135135
Instability index 65.8432432432
Isoelectric point 9.30364990234
Runs 5
Runs residual 0.0446317877511
Runs probability 0.0455043278572
Amino acid sequence MICKSKESSPTISFPPLFPHTHTSLFQLACKFGFPAK
Secondary structure LEELLLLLLLLLLLLLLLLLLLHHHHHHHHHLLLLLL
PRMN -
PiMo -
Name ENST00000414769.1_smProtein_443:556
Length 37
Molecular weight 4124.8464
Aromaticity 0.135135135135
Instability index 65.8432432432
Isoelectric point 9.30364990234
Runs 5
Runs residual 0.0446317877511
Runs probability 0.0455043278572
Amino acid sequence MICKSKESSPTISFPPLFPHTHTSLFQLACKFGFPAK
Secondary structure LEELLLLLLLLLLLLLLLLLLLHHHHHHHHHLLLLLL
PRMN -
PiMo -
Please cite: Chunlei Yu (2016) lncRNA: "ENST00000414769.1" in LncRNAWiki, available at http://lncrna.big.ac.cn/index.php?title=ENST00000414769.1&oldid=1272309 (Last update: Jul 01, 2016).
ContributorContribution Score*Edit Count#Summed Edit QuantityΛAveraged Edit QualityLatest Edit TimeEdit Details
Chunlei Yu1.8211182112016-06-25 14:31:50[show]
Contributors with score < 1 are excluded from the authorship.
ContributorContribution Score*Edit Count#Summed Edit QuantityΛAveraged Edit QualityLatest Edit TimeEdit Details
Lin Liu0.0313012016-07-01 20:26:53[show]
Note: For each edit version that is contributed by a specific person, his/her contribution is quantified as its edit quality multiplied by its edit quantity; the edit quantity amounts to the edit distance in comparsion with its previous version (that is, the minimum number of edit operations required to transform one string into the other), and the edit quality corresponds to whether the edit persists in comparison with the last version, ranging from -1, when the edit is entirely reverted (short-lived), to 1, indicating that the edit is totally preserved in the last version (long-lived). Please also note that contribution quantification may take time to reflect recent edits.
*Since one person may perform many discontinuous edits for a wiki page, contribution score is the sum of quantified contributions over all participated edits.
#Multiple successive edits provided by a researcher are counted as one edit.
ΛSummed edit quantity is the sum of edit quantities over all participated edits.
Averaged edit quality is the edit quality normalized over all participated edits.
Personal tools
Namespaces

Variants
Actions
Navigation
About
ScienceWikis
Toolbox