ENST00000344893.3

From LncRNAWiki
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000344893.3

Source

Gencode19

Same with

,

Classification

intergenic

Length

3381 nt

Genomic location

chr19+:11750591..11797382

Exon number

10

Exons

11750591..11750711,11755054..11755176,11757042..11757088,11759173..11759299,11761172..11761232,11762468..11762868,11789135..11789235,11791207..11791787,11793361..11793487,11795691..11797382

Genome context

Sequence
000001 GAAAAAGCCC GCGGCGTCTT CTCTGTCACC CGCGCTCGGC TCCCTGCTCG GTCGGGCTGG AACCTGTACT GGCAGCCGGA 000080
000081 GGTGTAGGTA GGAACCGGAA TACCTCGGAA GCCGGGAAAT GACGGAGTTT CATTCTTGTT GCCCAGGCTG GAGTGCAATG 000160
000161 GCGCGATCTC AGCTCACCAC AACCTCTGCC TCCCACATTC AAGCGATTCT CCTGCCTCAG CCTCCCGAGT AGCTGGGATT 000240
000241 ACAGTGTGGT GTGTTGAATA TTATAGTTTC AAAATCCTTC ATGTGTGTTA GGACTCAATG ATCTTTGAGG ATGTGGCTGT 000320
000321 GAACTTTACC CAGGAGGAGT GGGCTTTGCT GGATCCGTCC CAGAAGAAAC TCTACAGAGA TGTGATGTGG GAAATCATCA 000400
000401 GGAACCTGAT GTCTGTAGGA ATAAAATGGG AAGACCGGAA CATTGAAGAT CAGTACAAAA ATTCCAGGAG AAATCCAAGA 000480
000481 AATCATATGG CAGAGAGACT CTGTGAATGT AAAGATGGTC AATGTGGAGA AACTTTCAGC CTGATTCCAG ATGGTATAAT 000560
000561 GAACAAGAAC ACTCTTCCTG GGGTAAAACC ATGTGAAAGC AGTGTGTGTG GAGAAGGCAA CGTGGATCAT TCATCTCTGA 000640
000641 ATTGCTACAT CAGAGCTGAC ACTGGACACA AACCGTATGA GTGTCAGGAA CATGGAGAGA AGCCACATAA ATGTAAGCAG 000720
000721 TGTGTAAAAA CCTTCAGCTG CCTCCACTCC TTCCAAACAC ATGAAAAGCC TCACACAGGA GAGAAACCCT ATGATTGTAA 000800
000801 GGAATGGGAA AAAACCTTCG ATTCTCCCCA AACCGTTCGA AGATACAGGG TAGTGCACAG TGGAGATGGA CCTTATAAAT 000880
000881 GTTGAAGAAT TTGTGACCGT GGATAAGTTC GTTTCCTGTT ATGTGAACTT GGCAGATTAA TGCTAAATCC TGTGGGACAG 000960
000961 CATTTAGCAA CACCTAAAAA ACATGATAAA GAAATACCTG AGACTGGGTA ATTTATAAAG AAAAGAGGTT GAATTGGCCC 001040
001041 ATGATTCTGC AGACTGCACA GGAAGCATGG TACTGGAAGG ATGGCATCTG CTCAGCTTCT AGGGAGGCCT CAGGAAACTG 001120
001121 ACAATCATGG TGGAAGGCAA AGGGGGAGCA GCAGTTCACA CGGCCAGAGA AGGAGCAAGA GAGAGCAGGG CAAGGTGCCA 001200
001201 CAGACTTTTA AATGACCGGT TCTCACAAGA ACTTACCATC TCAAGAACAG CACCACAGGG ATAGTGCTAA ACCATTCATG 001280
001281 AAGGACCACC ATCCAGTCAC CTCCCACAAG GCCCCACCTT CAATATTGGG AATTACAATT CGACATGAGA TTTGGGTGGA 001360
001361 GATTCAAATC CAAACCATGT CCTTTTGCTT TTTTCTGTTT TGTTTGTGGA GTAGATTTTT CTCCATCCCT TTACTTTGAG 001440
001441 CCTAAGGGTG CCATTGCATG TGAGATGGGT CTCTTGAAGA CAGCATACCA TTGGATCTTG CTTTTTTATC CAAGTCACCA 001520
001521 CTGTGCCTTT TAATTGGGGC ATTTAGCCTG CTTACATTCA AGGACTCAGT GACCTTTGAG GATGTGGCTG TGAACTTCAC 001600
001601 CCAGGAGGAG TGGGCTTTGC TGGGTCCTTC CCAGAAGAAT CTCTACAGAG ATGTGATGTG GGAAACCTTC AGGAACCTGA 001680
001681 TGTCTGTAGA AGTCATATGG TAGAGAGAGT CTGAAGGTAA GGAAGATGGT CAATGTGAAG AGATCTTCAG CCTTGTTCCA 001760
001761 AATGGTATAG TGAAGACGAC TTTTACTGGA GTCAAATCAT GTGAAAGCAG TGTGTGTGAA GAAGGCAATA TGGATCATTC 001840
001841 ATCTCTTAAT TGCTGCATCA GAGCTGACAC TGGACACAAA TCAGATGAGT GTCAGCAACA TAGAAGCCAC ATAAGCAGTG 001920
001921 TGTGAAAACC TTCAGCTATT GCCACTCCTT TCAAACACAT GAAAGGCCTC ACACTGGAAA GAAACTCCAT GTAAGAAATG 002000
002001 TGGAAAAACC TTCATTTCTG TTCAAACCTT TTGAAGATAC ATGGTAATGC ACAGTGAAGA TGAACCTTAT AAATGTAAGT 002080
002081 TTTGTGGGAA GGCCTTTGAT AATCTACATT TATATCTTAC ACATGAAAGA ACTCACACTG GAGAGAAACC CTATGAATGT 002160
002161 AATAAATGTG GGAAAGCCTT CAGTTGTTCC AGTTCCATTC GAAAACATGC AAGAATTCAC ACTGGAGAGA AACCCTATAT 002240
002241 ATGTAAACAA TGTGGCAAAG CCTTTAGATA TTCCAGTTCT ATTCGAAATC ATGAAAACAC TCACACTGGT GAAAAACCCT 002320
002321 GTGAATGTAA GCAATGTGGG AAAGCCTTTA GTTATTCCAG TTACTTTCGA ATACATGAAA GAATTCACAC TGGAGAGCAG 002400
002401 GTGTATAAAT GTAAGGAATG TGGGAAAACA TTCACTTATC CCAGTGCCTT TCATAAACAT AAAAGTACCC ACACTTCACA 002480
002481 GAAACTTTAT GAATGTAAGG AATGTGGGAA AGCATTTGAT TGTTTTAGTT CCTTTCATAG TCATGAAGGG GTTCACACTG 002560
002561 GAGAGAAACC CTATGAATGC AGAACGTGGA AAAGCCTTCA GTAGTTCTAA GTACTTAAAA ATACATGGAA GAACTCACAC 002640
002641 TGGAGAGAAG TCCTATGCAG TAAAGAATGA GGGAAAGTAT TTTATTGTCT CAGTCCCCTT CAAAGACATG AAAGGACTCA 002720
002721 CATCAGAGAA AAGTTGTATG AATGTAAAAA ATGTGATAAA GCCTTCCATT CGTCCAGTAC TGTTAGAAAC CATGAAAGAA 002800
002801 GTCACATTTA AGAAAAACAC AGTGATGTTA GGAATATGGG GAACCTTTCC TTTCTCTTCC AGTCTTTGGA AGGCACAGGG 002880
002881 TATGACACAC TGGTGACCTT ATAACTGTAA GGAGTGTGGA TAAGTATTTA TTAGTCCTTG TGTGTTTTAG ATACATGAAA 002960
002961 GAATTTACTC AAAAGGAAAC TCTATGAATG TAAAGAATGT GGTAAAACCT GTGTAGTTTC AGTTTCTCTT GAATAAAGTC 003040
003041 ATTTCCTGGT ATTCTCAGGG GATTGGTTCC AGCACCCCTT GAGAATATAT AATTTTGCTC AAGTGCTTTA CAGAAAAGTG 003120
003121 TATTTGCCTA TAACTAGGCA ATCCTGTATA CTTTAAATCA TCTCTAGATT ACTTATAATA CCTAATGCAT TGTAAATGCT 003200
003201 ATGAAGACAA CTGTTTTATT GTATTTAGGG AAGTATGACA AGAAAAAACA TCTGTACATA TTCAGTACAG ACACAACCAC 003280
003281 CATACGGCTA CCTACCTAGT ACACATCATC TACAATATAA CATTTTCTTT TTAAAAAACA GTTATGGATT GGTTTCATTA 003360
003361 AATGACCTGC AAGCGTGTGT T
[back to top]

Predicted Small Protein

Name ENST00000344893.3_smProtein_1211:1438
Length 76
Molecular weight 8815.1775
Aromaticity 0.12
Instability index 62.168
Isoelectric point 8.80792236328
Runs 10
Runs residual 0.0156028368794
Runs probability 0.0168698109875
Amino acid sequence MTGSHKNLPSQEQHHRDSAKPFMKDHHPVTSHKAPPSILGITIRHEIWVEIQIQTMSFCF
FLFCLWSRFFSIPLL
Secondary structure LLLLLLLLLLHHHLLHHHLLHHHLLLLLLLLLLLLLLEEEEEEEEEEEEEEEEHHHHHHH
HHHHHHHHHLLLLLL
PRMN LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHH
HHHHHHHHHHLLLLL
PiMo iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiTTTTTTTT
TTTTTTTTTTooooo

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[XWDbCUU93VdrpSlsj7ExOgAAAAY] 2019-08-24 06:36:59: Fatal exception of type "TypeError"

Navigation menu