ENST00000336905.3

From LncRNAWiki
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000336905.3

Source

Gencode19

Same with

lnc-LIMS3-1:2,NONHSAT073166

Classification

intergenic

Length

2271 nt

Genomic location

chr2+:110745849..110753717

Exon number

2

Exons

110745849..110746379,110751978..110753717

Genome context

Sequence
000001 GCTTCATGAA TGCACACAGT CACGTCGCAG AAGTGCCCAC CCAGCTTCTG CCCATTGAGG GTCTCAAGCA GAGAGCGTGA 000080
000081 GAAGTTCTGC AGATGTATGT GGCGCACAGC CTCTACAGCC GCCGACTCCG ACTCCTCTTC AGGCACCAGG CCTGGCCGTG 000160
000161 GCCGCCTTCT CACCGACTCC AAGGCAGCAC TTCCGGGCGC TTCTCTTTAT TTTTATACAG TTTTATTGAG ATATAATTTA 000240
000241 CATGCTATCC AGCCCATCTA TTTCAAGTGT ACCATGCAAG GGGTTTGTAT ATATTCACAG AGTTGTGTAT CCATCACCAT 000320
000321 CGTTTTAGAA CATTCATCAC TCCAGAAGAA ACTACGTACC CATCAGCAGC CACTGCCCAT TTCCCTGATC TGCCCCGCCC 000400
000401 TAGGAAATCC GTAATCACTT TCAGTCTATG GATTTGCCTA TTCTAGACCA TTCATATAAA TGAAGTCACA CAACACTGGG 000480
000481 TCTTATGTGA CTGGCTTCTA TCAAAGTTTG CAAGGTTCAT TTATGTTCAT GGGCTGACCC CACATTGGAC ACCGCTGCAT 000560
000561 CCATGTCCAT CACACAACAC AGCTGCCGTT TCTTCTGCCT GCTTATGGGA AAGTCCCCTC TTCTCCTCCG TTTTCTTCTC 000640
000641 TTCCTGCCCT ATCACACCGT GCACTTCTCC CTTTCCTTAA AGAACCACCA TCAACTTTAG GAGGAGGGAA AGGGGTGGCT 000720
000721 CTGGCAGGAA AAGCCAGAAT CCCCTCTAGC CAGCAGAGAG AGAGAGGAAT GGCTGCATGT TTTCTCCCCC AGTCCAAGGC 000800
000801 ACTGGGTCTT GGCTGGGTTG AAGGTTCCAA GCTGCTCTCC TGCTGTGTCG GTGAGTTCTG GTCAACCTGC AACCTCCTGA 000880
000881 TATGGCCATT GCAGTTCATC GAGTCTTCAG GGACTCCCCA TGGCCTGGAG TACTTTGCCT TGCTTACACG GGAGAGGAGA 000960
000961 ATGGATTTAT AGAGAACATC ATCTAAATCC AACTTGACCA TTGTGTGGCC ACACTTGCTA GATTGCTATA GTCTAAATCT 001040
001041 AGCATTGTAG AAAGACGGGG GAGCTTGGAG CTGCACAAAC CCAGGTCTGG AACTGGCTCC TTACCTTGGA AGGTGAATGA 001120
001121 TCCTGCCAGG ACTCTTAGCC TCCCTGGGTC TCAATTTCTT TATCTGTTTC ATGGGAATGA GGATCTCTGC TGGGTGGTTG 001200
001201 GGTGATGTGG GGGCTGTGTG AAAACAGCTT GTCAATACAA GCCAAAATAG AAATATTTCT CCACAGAGTA TGAAGGTCAA 001280
001281 ATGAGAGAAT ACATTTAAAT TAAATGGAAA ATTAAAATGG TAAAAAATGC AAAGCTGTAT TGAAAGTTCC GAGCTTCTCT 001360
001361 ATAAGGAGCT TTTTGACTAT GGAAGAATCC TGTACTCGTT CCCCCTAAAT ATAAAAAAAA AGTTGAAGGA GGCAGAAGGG 001440
001441 AGAGTGATGC ACGATGGGCA AGGACTTCAC CTGCTGTTGC TGGCTTTGAG GATGGAGGAA GGAGGCCACA AACCTAGAAG 001520
001521 CTGGAGCCCC TAGAAGCTAG AAAAGGCAGG GACCCGATTC TTTCCTTGAG CCTCCAGAAG GGACACAGCC CCGCCAGCAC 001600
001601 CTTGACTTTA GCCTGGTGAG ATCCTCTTAG GACTTTTGGC AATCAGAACT ATAAGACAGA AATGGAAGCC ACTGAGTCTG 001680
001681 TAGCTGTTTG TTGCAGCAGC AATAGAAAAC TAATGCAGGG CCCAAGAAAT CACTGGTGAT GAGATCGGGA AAGTGGGCTC 001760
001761 AGGAGGTCTG GATCTGTGAT GAGATGGGGA AAGTGGGCTC AAGAGGTCTG GATCTGTGGT GAGATGGGGG AAGTGGGCTC 001840
001841 AGGAGGTCTG GATCTGTGAT GAGATGGGGA AAGTGGGCTC AGGAGGTCTG GATCTGTGAT GAGATGGGGA AAGTGGGCTC 001920
001921 AGGAGGTCTG GATCTGTGAT GAGATGGGGG AAGTGGGCTC AGGAGGTCTG GATCTGTGAT GAGATGGGGG AAGTGGGCTC 002000
002001 AGGAGGTCTG GATCTGTGAT GAGATGGGGG AAGTGGGCTC AGGAGGTCTG GATCTGTGAT GAGATGGGGA AAGTGGGCTC 002080
002081 AGGAGGTCTG GATCTGTGAT GAGATCGGGA AAGTGGGCTC AAGAGGTCTG GATCTGTGGT GAGATGGGGG AAGTGGGCTC 002160
002161 AGGAGGTCTG GATCTGTGAT GAGATGGGGA AAGTGGGCTC AGGAGGTCTG GATCTGTGAT GAGATGGGGG AAGTGGGCTC 002240
002241 AGGAGGTCTG GATCTGGGGT GGGGATCTGG A
[back to top]

Predicted Small Protein

Name ENST00000336905.3_smProtein_92:235
Length 48
Molecular weight 5709.5488
Aromaticity 0.191489361702
Instability index 65.4659574468
Isoelectric point 11.3629760742
Runs 9
Runs residual 0.0252127659574
Runs probability 0.0156627215451
Amino acid sequence MYVAHSLYSRRLRLLFRHQAWPWPPSHRLQGSTSGRFSLFLYSFIEI
Secondary structure LEELLLHHHHHHHHHHHHHLLLLLLLLLLLLLLLLLEEHHHHHHEEL
PRMN -
PiMo -

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[XWDesqX-qNrGhrJUuT9XYgAAAAE] 2019-08-24 06:52:36: Fatal exception of type "TypeError"

Navigation menu