ENST00000334146.3

From LncRNAWiki
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000334146.3

Source

Gencode19

Same with

lnc-TLCD2-1:10

Classification

intergenic

Length

1365 nt

Genomic location

chr17-:1614805..1619504

Exon number

4

Exons

1614805..1615693,1616997..1617308,1617665..1617747,1619424..1619504

Genome context

Sequence
000001 AAGAGACAGC GCCGCCGGCC GTGGGGAGCG GACGCAGTGA TTTGCTCCCC CTCGTGCAGC AACCCCCACA CCCAGCACCA 000080
000081 GGCCCCCAGA ACTCTCCTTC CAGCTGAACT CCCTGGGAAC AAGTCAGTTG GGCTGATCAC TGAACTCACA TTTCTGGACC 000160
000161 TGAGGAGCCT GTTCCTCTCA CGCCCTCACC TGGCTGAGCC GCAGTAGTTC TTCAGTGGCA AGCTTTATGT CCTGACCCAG 000240
000241 CTAAAGCTGC CAGTTGAAGA ACTGTTGCCC TCTGCCCCTG GCTTCGAGGA GGAGGAGGAG CTGCTTTCCC CATCATCTGG 000320
000321 AAGGTGACAG AAATGGGCTG GGAAGGTCCG AACAGCAGGG TGGATGATAC GTTTTGGGCA AGTTGGAGAG CCTTTGCCCA 000400
000401 GATTGGCCCA GCAAGGAGCG GTTTTAGATT AGAGACACTG GCTGGATTGA GGAGTAGAAG GCTCAAACAA CCCAAGGCTT 000480
000481 TCTGCCTCCG AGATGTGGCA CCATAGTGCG GTGCCCTGTG GCTTCACCGC CCTACTTCCA CCTCCGCCCA GCCTGTAATG 000560
000561 TTTATATAAG CAGCCTCAAG GACCAAGAAC CATCTGCGAA AGGACACACA CAGGAAATTC ATAAAAGAAA TCTGAATGGA 000640
000641 TAAAACCATG AAAAAAAGTA TGCTTCATTA GTAATTAAAG AAAGGCAAAT AGAGCTGGAA GCATTTTTCC CTTAGCAAAC 000720
000721 CATAACAGAA AAAAATAAGA CCCAATATTG GCAAAGAGAC TACTGAAAAA ACATTCCCAT ACATTGCGTG TGGGAGTATA 000800
000801 CATCGGTGCA GGCTTCCTGG ATGACAGTTG GGTGATATGT GTCATGTGGC CTAAAAGCCT CCATGTCATT TGACCTACGA 000880
000881 ATTCTATCTT TGGGAATTTA TCCTAAGAAA ATACTTAAGG ATTTAGTTAG TGATAAGATG TTCATCCCAG CATTGCAATG 000960
000961 GAGAAAAATG GGAAGCAATG GTTTGGTTGG GAATTTATTC CTTTTCTGCT GTAACGAAAG TTTGCAATAG GGGATTGCTT 001040
001041 AAGTAAATTA TTGTATCTCC ATCCAGATGG TGGAGTACCG CGCAGACATT AAAAGTCATG TAAAAGAACA TCTGACTGAA 001120
001121 AGAAAAATGC TCCTTGAATA TTAAAAGGTT GTAAAAATAG TGCATGTTAT GTGATTTCAA TTTTGTTTTT TAAAATATGG 001200
001201 GTGTATGCTT GTATACGTAG AGCAGATAAA AAAGACGGAA GGCATACTAA AAAATGTTGA GTGGTTATCT TTGTATGGTG 001280
001281 GAACAAAGTC ACTGTAATTT TCATCTTTGG TTTTTCTGTA ATTTCCAAAT TTTCCACATT TTGTATTTCA TATAATATAA 001360
001361 TTTAA
[back to top]

Predicted Small Protein

Name ENST00000334146.3_smProtein_332:505
Length 58
Molecular weight 6478.3477
Aromaticity 0.122807017544
Instability index 61.4
Isoelectric point 11.2123413086
Runs 9
Runs residual 0.00394736842105
Runs probability 0.0473709003121
Amino acid sequence MGWEGPNSRVDDTFWASWRAFAQIGPARSGFRLETLAGLRSRRLKQPKAFCLRDVAP
Secondary structure LLLLLLLLLLLLLHHHHHHHHHHHLLLLLLLLHHHHHHLLHHHLLLLLLEELLLLLL
PRMN -
PiMo -

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[XWD480U93VdrpSlsj7Ey5gAAAAY] 2019-08-24 08:44:38: Fatal exception of type "TypeError"

Navigation menu