ENST00000316148.4

From LncRNAWiki
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000316148.4

Source

Gencode19

Same with

lnc-MORF4L1-2:1,NONHSAT047634

Classification

antisense

Length

1900 nt

Genomic location

chr15+:79271231..79278268

Exon number

2

Exons

79271231..79271665,79276804..79278268

Genome context

Sequence
000001 GTGCTGCAGG GAGCAGGGGA ATGTGGGAGA GACACTTACA CGGGCCCACA GGCCACCTGA AAGAGGGAAG ACGGTCAGGG 000080
000081 TGGGGACTCA GACAGAATGG GGGGCCCCAG AGGCAGTGGA GGCAGCGGTG GTGGCGGCGG CAGACGAGGA AGCCAGCCAT 000160
000161 GTGAGGAGGT GGATGGAGTG GTGCCCCGGG GGCGGACGGA CGGACAAGTT GGTGAATGCA CGGAGGGGGC AGCTCCCCAC 000240
000241 AAGCACAGTC CACAGGGGCT CTCGGGAGCC CAGGCAGAAG AGAGACGGCT GGACAGCACA GATGGGTGCA ACATCTGTCT 000320
000321 GAGGACACAA ACAAAGTGGA GATGGTCAAG GCGATGGCAC ACAGAGCTGG CAAAGGACAG ACCAAATGCG GCAGGAAGAA 000400
000401 AACGCAAAGA GGAGGCAGAC GAGGCTGGCA GAGGGGTTCA TGTTCTGAGT GAAGAGGGAT TGAGCACACA TTTAAGGTGA 000480
000481 TCAACTAGCC AACACGTTCC AGGAAGCAGC TAACTCTCTG TGGCCAGAAG CGCAGGTGAA ATTAGAATCC TGGGAAGGGG 000560
000561 CTTGCAGGAT CATCTGACGG AAGTGTCCTC TGACGGAAGG GTCCTCCGAT GGAAGGGTCC TCTGATGGAA GGGTCATCTG 000640
000641 ACCACTGTCT CAGCTGCCCT GCAGATCCCC ATAAAGCCAC CACTCTTGCC CCAACTCCAG AAGAAAAATG TTGGGACCAA 000720
000721 TAATCACCAT CATATTCTTT CCACTTTGAG GTATTAATTA CTCAAGTGGG GATTACAGTC CAGGTCTCAC TGCCATATCT 000800
000801 GTGGGCCTGC TATCTGGTCC CAGGTGATAT AGGGGAAGCT ATTCTGTTTT ACCTGGGAGT GTTAGACCTC AGCCCAGTAC 000880
000881 TTTGCCCACT TGTGGATGCC CAGTGGCCAG CCCACGGGTC TTCCTGCCCT AGCCCCAATC CAGCCCCAGG GAGGCAGTGG 000960
000961 TGCCAGCCTC CTGCCCGCAC CTGCTTAGAG ACTTTGAGCC ACGTCTTTTT GAGCCGGAAG ATTGCACTGC GGTTCATGGA 001040
001041 CGAGGTGATC TCCAGTACGG CATTGTAGTT GTGGAGGCAG CGGCATATGT CAGCTACGGC CACCCACTTC TCGATGGCGC 001120
001121 TCACCCTGGC GTTGATGTCC TCATTGCGGA TGATTTCTGA AGCAATCAAG TTACTGATCT TTAAGCCGAT GCAATAAGAC 001200
001201 AGGGAAAAAG AGGAGTAAGT ATTGCAAAGA TGATAAATGG TCACTATTTG CAGATATGAT TGCCTGCTTG AAAATACAAG 001280
001281 AAGGAATTGG AAAACTACGA GAACAACTAA CAGAGCTTGC TAGGGTTGCT GGCTAAAGGT TCAATATACA AAAATGAAAA 001360
001361 GTTTATATAT ACATTAGCAA TAATCAATTA GAAAATACAA CAAAAATACA ACCTTCCAAA TAACAATGGG AATCTGTAAA 001440
001441 TACCTAGGAA CTTAATGAGA ACTATGTAGG ATGGAAAAAA CAGGTCACCA AAGGATATAA AAGGCTTGAA TAACAGAGAA 001520
001521 AGAGATCAAA TTCCCAAATG GGAATGTAAA TATGTCATTT TTCTGACAAC TAATACATGT GTTTAATGTA ATCCAATAAA 001600
001601 ACACTCAGGC CAGGCGCGGT GGCTCACACC TGTAATCCCA GCACTTTGGG AGGCCGAGGC AGGCGAATCA TTTGAAGTCA 001680
001681 GGAGTTCAAG ACCAGCCTGA CCAACATGGT GAAACCCTGT CTCTACAAAA AATACACACA CAAAAAAAAT TAGCTGGGCG 001760
001761 TGATGGCGCA TGCCTGTAAT CTCAGCTACT TGAAAAACTG AGGCAGGAAA ATCACTTGAA CCCAGGAGGT GGATGTTTCA 001840
001841 GTGAGCCAAG ATTGCGCTGC TGCACTCCAG CCTGGGTGAC AGAGCGAGAC TCCATCTCAG
[back to top]

Predicted Small Protein

Name ENST00000316148.4_smProtein_215:451
Length 79
Molecular weight 8414.3064
Aromaticity 0.025641025641
Instability index 66.2141025641
Isoelectric point 11.2416381836
Runs 7
Runs residual 0.0439337085679
Runs probability 0.0483130189014
Amino acid sequence MHGGGSSPQAQSTGALGSPGRRETAGQHRWVQHLSEDTNKVEMVKAMAHRAGKGQTKCGR
KKTQRGGRRGWQRGSCSE
Secondary structure LLLLLLLLLLLLLLLLLLLLLLLLLLLLEEEEEELLLLLHHHHHHHHHHHHLLLLLLLLL
LLLLLLLLLLLEELLLLL
PRMN -
PiMo -

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[XWDnaoOWBhuq6w6dG@kz8AAAAAQ] 2019-08-24 07:29:48: Fatal exception of type "TypeError"

Navigation menu