ENST00000315293.2

From LncRNAWiki
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000315293.2

Source

Gencode19

Same with

lnc-FAM27B-3:1

Classification

intergenic

Length

2566 nt

Genomic location

chr9-:67017400..67032072

Exon number

4

Exons

67017400..67019064,67026663..67026815,67029157..67029264,67031433..67032072

Genome context

Sequence
000001 AGTGCTCCTG CTGACCTTCC CTGTCTGCAG CCCAGCTTTG GACTGTGGAG ATGCCCTCAG CCTCTACTCA GTGGCTCCAG 000080
000081 CCTCATATTT GCGTGCTATA CCTTTAACCT CAAGTTCTCT TGCTGCTAAC TTAAGCTGTG ACTGTCCAGG ACCTGCACAC 000160
000161 ACACATATAT GCACGCATGC ACACACACAC ACACACACAC ACACGCAGAA GGTGAACACA CAGGATGAGG CCCTGAAAAC 000240
000241 TCATTTCACC CGTGTACCTC ACCCAAAAAT TCCCCTTTGT ACTCCTATCT TTATCTCTAA CAGACAGCAT GAAGGTAGCC 000320
000321 CGAAGTCCCC TCACCCTGTC TGTCCTCCTG ATTCTCTAGC CCAGTTCCCT CTAGCTCCAG CACAGACTCT TATCTCCAGC 000400
000401 CCTGACTGCT GAAACCCTCC AGCCCCAGCT CCAGCCCCTC AGGAGGGGAC TGCGTGGGAG GAATGACTCC AGCAAGCCGG 000480
000481 CAGCTGACCC GTGTCTGGCC TGCATGCCTC CCCCTGTGGT CCACTGCCGG TGGTCTTCAG CTCTCTCCTC GTCCCACCCC 000560
000561 CATGGTCTGC TGACAGCCCA GCCCAGTGCA TCCCTGCCAT CTCTGCTCTA CCGCTGGTCC TCCCAACAAC CAACTTACAG 000640
000641 CTTCCAATTG TGGACAAGAT AAGGACCATT GCCCAGGCTG TCTATGGAGC CAAAGATATC GAACTCTGTC CTGAGGCACA 000720
000721 AGTCAAAATA GATCGTTACA CTCAGCAGGG TTTTGGAAAT TTGCCCATCT GCATGGCAAA GACCGATCTT TCTCTGTCTC 000800
000801 ACCAACCTGA CAAAAAAGGT GTGCCAAGGG ACTTCATCTT ACCTATCAGT GATGTCCGGG CCAGCATAGG TGCTGGGTTC 000880
000881 ATTTACCCTT TGGTCGGAAC GGTGCACCAC TGACATCATG GCTCGGCTGG ACTCTGGAAA GCAGGAAATT GCTGGAGCAT 000960
000961 GTTTGGGCAT CAATGATGTC ATCCGCTACG AATGCCGGGT GGGGTTACTG GACTGAGGGC CATGAAAAAA GAAAGCTGCG 001040
001041 GCCCTGCCCC GTGGACTCAC TGCCATTCTG TTCTTTCTCA CGTTTCAGTT CAGCTCACTT TGTTTTCCGT CCCCCTCCCT 001120
001121 CTACTGTAAA AGTATGTACT CAGTGTTTCA TTTCCTGCTG GATCTGATTC AGGTCAGTGA TGAAGTTCTT TGCGAGCTCA 001200
001201 GTGGGGAGGC GTTTCCTCCC TTTCATACCG GCCCTGCTTA GGGATGCATG GTTGGTTATA TACTTGCTTC ACTCGGTTAG 001280
001281 GCATGGAGGA GAATTCATTC AGACCTCATA GGTTTAAATC AAATGCATGA CCCTTCACAT TTTCCAGAGA TTTAGACAGT 001360
001361 TACAGTGAGA CAATTAAACA TTCACCCCCC AAGCTGCACT TGGAGATGTG TAAGCAGTAA TGTAGTCATG CGCTCCCCAT 001440
001441 GATATGAGAG TGTGCAGAAT GCCACTCCCC ACAGCAGGTC CACCAGGACC TCCTCAGGGA GCATCTTGCC TACAAAATCA 001520
001521 CCCATCCCTT TTCCCCCACT TTCTTCACTT TCCCTACGTT TCCACTCCCA CACCCACAAA TAAACAAAGA AACTTTGAGC 001600
001601 TTATTTTACA AAAGTCTTTG AAATGGCCCT CCTCTCTCCG ATGCTCCTGG GCCCTGGTTT GGCCCCATCT GTGCAGTCTC 001680
001681 TCTGATGAGT GTGAAATAAG CCAGGTTTGG CTCATGCTCT CCCTGTGAGC TTGCTCTCCC CGTGAGCCTG CCCTCTCCAT 001760
001761 CTGGCCTCAC TTTGTTTGTG TCCCTGGGTC CTTTGTCTCT GATCCTGGGA TCCTGGTGGT TTCCTCCTCC CCGCCCAGCT 001840
001841 TGGGTCCTTT TCCCCAGGGT TCTTCCCTAT CTCTACATCA GAATTTCCTG CTTTCTCCCA AATATGCATT TCCCTGGCCC 001920
001921 AGGCATCCAT TGCTTCCTCT CATCGTGAGG TCCCTGCAGC AGACTGCCAA TGGTGTTGTG GCCATGCCTT CCTCCACAAC 002000
002001 CCAGGGAAAG CTACATGTGT GTCTGTCCCA TAGGGAAGGA GTCATCCCTG TCTCTTCAGT GTGGCATGTT CAGGAGGAAG 002080
002081 GAAAGTAACC AGCGTCATTC TCAATTTACG GAAACTGTTT ATCATATTGA CAAGAAGAAG AAAGCTTTGC GACTCATGAG 002160
002161 AATGATGTTT TCTTCTCTGG TACATAAGGT TATGTAGGTC CAATCCATTG TGTAGAAGAT CTTTTCTCCC TTAATGGGAT 002240
002241 GTACACTTAT TTTTAGCACA AGTATAAAAC TACTTTAAAT GAAGTCAGCC TCAGCCAGGG AAATATGCTG AGTAATAATG 002320
002321 TTGCCAGGTA CTATACCACT GAGTTGAGTT TGCAATTCAC TGCTATTAAT CCCTGCATGT TAGTTCTGAA TTTTTACTCT 002400
002401 TTGCATACGT AGAAAAAATG GTGTTTCTCT TCAGAGTCAA GGAGGGAAAA AAGAAAAGTT AAAAGACACT TATAACACTT 002480
002481 TTGTGTCCAC CCCTAAAATC AGCATATTGA TCTACTATTT TTCTAGGTAT TGATGGAATA TTGACTCATA TACTTTCATA 002560
002561 CAACTG
[back to top]

Predicted Small Protein

Name ENST00000315293.2_smProtein_503:661
Length 53
Molecular weight 5878.6145
Aromaticity 0.115384615385
Instability index 88.0057692308
Isoelectric point 10.0443725586
Runs 8
Runs residual 0.00347674923946
Runs probability 0.0452548136372
Amino acid sequence MPPPVVHCRWSSALSSSHPHGLLTAQPSASLPSLLYRWSSQQPTYSFQLWTR
Secondary structure LLLLEEEEELLLLLLLLLLLLLLLLLLLLLLLHHHEEELLLLLLEEEEEEEL
PRMN -
PiMo -

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[XWEKRR7zfgbxLLvWP3dTvwAAAAM] 2019-08-24 09:58:31: Fatal exception of type "TypeError"

Navigation menu