ENST00000313807.4

From LncRNAWiki
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000313807.4

Source

Gencode19

Same with

lnc-SPG11-1:1

Classification

intergenic

Length

2863 nt

Genomic location

chr15-:44825691..44829121

Exon number

2

Exons

44825691..44827672,44828241..44829121

Genome context

Sequence
000001 AGGGAGGGGC ACAGGGGGCT GAGGAGTGCT GGGTCGGGCT TCCAGCTCCC TACAACGCAG ACCAGTACTG GAGTTCGTGG 000080
000081 TGCTGGAAGA CCGCCGCCCG ACTCTGGGCC CCGGGTAGGA AACGTAAGTG CCAGGAAGTT AGCAGAGTGG TTCTTTGGCT 000160
000161 GGCGCCTGAA CCTCGCCAGT CTTCGTCGCC CCTCCCCTGC CAACGCCTAC CCCGCTTCGA CCGGAGGGTG CGCTGTCCCT 000240
000241 CTGGTCACTG TGATCACCGT CCATGGCCGC CTGCGGATAC CCACGCCGTG CTCAGAAGAG GGCTCTGAGG CCACGCCCGC 000320
000321 CTGTGGGGTC GGTGGCCGGG CTTCCGGGAC CCCAGAGGGA GTCGTCGCGC GCTAGGTGGA GGGGACCCCT CTGGAATCCG 000400
000401 GCGATCCCCG GGCGCAGATG CAGGAGCGGG TGGGGAGAGC CGCGTTCCTG GCATGTTTGC CTCGAGTTAG TCACGAAGGA 000480
000481 ATCGAAGAGA GCCTTAGTCT TCGAGGCTTT TCCCTTCCTG TGAGCCCCTT TGAGGCCAGC ACATTGATTT TTTTTTCTTT 000560
000561 CGCAGAACAA TTTCGGACCT CCTGGGGTCT ATGCTAGGTA TGAGGTGTAT CTTTGCCCTC CATCAAGTAG CAAAGATGGA 000640
000641 CATGTAAACA AATTTCGACA CTGTGATGAC TGCCACAAAA AGCAGCATTA TGAGGTTGAA TGTAAAAGGA TAACCTTAGC 000720
000721 GGCGGCGGGG GCCGGAGGAT GAAGGAAGGC TTCCTGAGGT AGGCGCTGGT TGAAACTGAA GTTGGAGAGA GCAAGTGGCA 000800
000801 TTTGCTGAAG TGCATTTCCG GTAGAAAACT CCAGTGGTCC CTCACCTGAC TGAGTGGCGC AGTCAGAGAT AAATGGAACA 000880
000881 GAGTCTACAA ATAAACATTT TATAAAGATG ATCCTTCAAT ACATATTCTA CAGCCCAGTT AAAATGTGAG AGGCCATGAT 000960
000961 CTACAGACAG CCATTTATAA AGGTGGATCA GGGCCGGACA CGGTGGCTCA ACGTCTGTAA TCCCGGCACT GTGGGAGGCC 001040
001041 AAAGCGGGAG GATCGCTTGA GCCCAGGAGT TCGAGACCAA CCTGGCCAAC ATGGTGAGAC CCCATCTTTA CAAAAAAATA 001120
001121 TATATATCCA GGCATAGTGG TGTGCACCTG TGGTCCTGTG GTCCCAGCTA CTCAGGAAGC TGAGGCAGTT GAGGCTGCAG 001200
001201 TGAGCCACGT TCTGGCCACT ACACTCCAGC CTGGGCATCA AAGTGACAAG ACCAAAAAAA AAAAAAAATG TGGATTGGAA 001280
001281 GGAGGCAAGA AAGAAGTCAG GAAAAGGGTG GAATGTAAGT CCCTAAGGAC ACAATCTTAC TCACAATTGT ATCTCCAACA 001360
001361 TTTGGCATAA TGCCTAATAC GTAAGTATTT TATGAATTAA TTAAACGAGA ACACAAGCCT AAATTAAGGC AATGGCAATG 001440
001441 GAGAAGAAGA AACCAACTTG AGAAATATTT AAAGGTCATT GTCAATGGAA CTTAGTGACT TTAATGGTTA ATTTTATCTA 001520
001521 TCAACTTGGC TAGGCGATGC TACCCATGTT ACTCAGTTTT TGGTCAAACA CTAGTCTAGT TGTTGCTATG AATTGTATTT 001600
001601 GTTAGATGTG ATTAACATTT AAATCAGCAG ACTTTGATTA AAGTACATTA CCCTCTATAA TGAGGGTGGG CCGCATCCGG 001680
001681 TCAGTTCAAA TTAAAACGAG ACCCTTAAGA AGAAGCAATT CAGCCTCCAG ACTGCAGCGT CAAATCTCCC TGGGTCTCCA 001760
001761 GGCTGTTTGT CTGCCCTGCA GATTTCAGAC TTGCCAGCTC CCAGAATAAT GTGAGCCAAT TCCTTAAAAT AAATCTCTTT 001840
001841 CTGCATATAC ACATCCTATT GATTCTGTTT CTCTGGAGAA CCCGTACTAA TATAGTGTCT GACTAGATAT GAAGGAGGAG 001920
001921 GGGAAGGGAG AAATAGATAG ACGATGCCTT TGGATATTGA GTGACACTTA TCTAGTTGCT TAAGTCAAAA ACCTGAAAAC 002000
002001 TGGTTAGGCA CGCCTATTAC GGGCTCACGC CTGTAATCCC AGCACTTAGG GAGGCTGAGG CAGGCAGATC ATTTGAAGTA 002080
002081 ATTCAAGACC AGCCTGGCCA ACATGATGAA ACCCCAAGAC CACTAAAAAT ACAAAAATTA GCCGGGCGTG GTGGCACATG 002160
002161 CCTGTAACCC CAGCTCCTCA GGAGGCTAAA GCAGGAAAAT TGCTTGAACC CAGGAAACAG AGGTTGCAGT GAGCCGAGAT 002240
002241 TGTGCTACTC CACTCCAGCC TGGGAGAGAC TCCATCTGAA AACAAACAAC AAAAAAAAAT GCTGGGCACA GTGGCTCACG 002320
002321 CCTGTAATCC CAGCACTTTA GGAGGCTGAG GCGGGCGGAT CACCTGAGGT CAGGAGTTCA AGACCAGCCT GGCCAATGTG 002400
002401 GCAAACCCCA TCTCTACTAA AAATAAAAAA AAAATTAGCT GGGCATGTTG GCGGGCACCG TAATACCAGC TACTCGGGAA 002480
002481 GATGAGGCAG GAGAATCACT TGAACCGGGA GGCAGAAGTT GCAGTGAGCT AAGATCGCGC CATTGCACTT TAGCCTGGGC 002560
002561 GACGAGCGAA ACTCCCTCTC AAAAAAAAAG AAGAAGGCTG GGCGCGGTGG CTCATGCCTG TAATCCCAGC ACTTTGGGAG 002640
002641 GCCGAGGTGG GTGGATCACT TGAGGTCAGT AGTTCGAGAC TAGCCTGGAC ATGGTGAAAC CTGTCTCTAC TAAAAATACA 002720
002721 AAAATTAGCC AGGTATAGTG GCTCATGCCT ATAATTCCAG CTACTTGGGA GGTTGAGGCA GGACAATGGT TTGAACCCAG 002800
002801 GAGGCAGAGG TTGTAGTGAG CTGAGATTGT GCCACTGCAC TCCAGCCTGG ATGACACTCT ATC
[back to top]

Predicted Small Protein

Name ENST00000313807.4_smProtein_2444:2662
Length 73
Molecular weight 7634.5087
Aromaticity 0.0277777777778
Instability index 87.9680555556
Isoelectric point 9.14691162109
Runs 13
Runs residual 0.0396390916464
Runs probability 0.0428369546018
Amino acid sequence MLAGTVIPATREDEAGESLEPGGRSCSELRSRHCTLAWATSETPSQKKRRRLGAVAHACN
PSTLGGRGGWIT
Secondary structure LLLLEELLLLLLLLLLLLLLLLLLLHHHHHLLLLEEEEELLLLLLHHHHHHLLLEEEEEL
LLLLLLLLLEEL
PRMN -
PiMo -