ENST00000313064.2

From LncRNAWiki
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000313064.2

Source

Gencode19

Same with

lnc-NMUR1-1:1,NONHSAT077373

Classification

intergenic

Length

1282 nt

Genomic location

chr2-:232373137..232379050

Exon number

3

Exons

232373137..232374054,232378238..232378343,232378793..232379050

Genome context

Sequence
000001 GAGGGCGTCA CCAGCGTGTC GGCGCCTGCG GTTTTCTTCG GGCTGTCCCC AGGCGTCGTG CCCGCGTCCG TCACGCGCGG 000080
000081 TGGCTTGCAG GGGCGCACCG CGACAGCCTT AAAGGAAAAC CTGTTAGGGA CAAGGGCTGC TGTGGGCAGC GAGGGTTATA 000160
000161 GACTCATGTG TGTTCTGAAT TCTGGTGGGG GTAGTGATGG ACGCTGACCC AGTTCACAGA ATTATCTGAC TGGCGAAGTA 000240
000241 AAGGTACTTG AATTGCAGGA AAAAAGGTCA AGGTGAACTG AAGAAAATAA GTCTTTCCCC AAAGGAGGTA GAAGATGGGG 000320
000321 AAGATGAGAT GTCAGAAGCT AAGGACAATG GCAGTAGAGA TGAGGTTCTT GTCCCTCATA AGAATTGCAG GAAGAATACC 000400
000401 ACTGTCCCGG GAAAGAAAGG GGAGGAAAAG TCTCTGGCTC CTGTGTTTGC TGAGAAGTTA ATATCACCAA GCAGGAGGGG 000480
000481 AGCCAAGCTC AAGGACCGTG AGAGCCACCA GGAGAATGAA GACAGGAACA GTGAGTTGGA CCAGGATGAG GAAGATAAAG 000560
000561 AATCCTTCTG TAGGGGGTTC CCGATGAGTG GCTGTGAGTT AGAGACAAGC TGCTGTGTGT GCCATTCTAC AGCACTTGGG 000640
000641 GAGAGGTTCT GTTAAAAATC CATCCCTCTG AAAACTGCCT TGGCAATTCC CGGCTGATTC TTCGGGATGG GCCTCATTGA 000720
000721 TGGGGAGTCT CAGTGGATGT TTGACTTTTG CTTTCTACCT GACCCTAGTC AGAGATTTTT TCTTTTTCCT TTTTTTTTTT 000800
000801 TTTTTTTTTC TGAGACAGAG TCTTGCTCTG TCACCCAGGT TGGAGTGCAT TGGTGTGGTC TTGGCTCACT GCAGCCTCTG 000880
000881 CCTCCTGAGT AGCTGGGACT ACAGGCGCAC ACCACCACAC TGGCTAATTT TTGTATTTTT AGTAGAGATG GGGTTTCGCC 000960
000961 ATGTTGGCCA GGCCATCTTG AACTCCTGAC CTGAAGTGAC CTTCCCACCT TGGCCCCCCA AAGTGCTGGG ATTACAGGCA 001040
001041 TGAGCCACCA TGCCTAGCCC AGAAATTTTC TCTTTGAATA CTATACATTG ATGAGTTCTG TCTTTATGCT TATGATCCAC 001120
001121 GCAGGTAGGT CGTCTCAGAT TTAATTTTCA GTGGTTTTTT TCTGTCTTGA TGGAGTCTGT GTAACATTTA AAATATTGCT 001200
001201 ACCAAAGCAG TAATTCTTAC TATAGTTATT AAAATGCAAG AACAATATAT TTAAAATTAT TTCATAATAA AGTTAAAATG 001280
001281 AG
[back to top]

Predicted Small Protein

Name ENST00000313064.2_smProtein_719:988
Length 90
Molecular weight 10412.2722
Aromaticity 0.213483146067
Instability index 49.0574157303
Isoelectric point 8.50823974609
Runs 11
Runs residual 0.0196078431373
Runs probability 0.0468596939186
Amino acid sequence MGSLSGCLTFAFYLTLVRDFFFFLFFFFFFLRQSLALSPRLECIGVVLAHCSLCLLSSWD
YRRTPPHWLIFVFLVEMGFRHVGQAILNS
Secondary structure LLLHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHLLLLEEEEEHHHHHHHHHHHLLLL
LLLLLLLEEEEEEHHHHLHHHHHHHHLLL
PRMN LLLLLLLLLLLLHHHHHHHHHHHHHHHHHHHHHHLLLLHHHHHHHHHHHHHHHHHHLLLL
LLLLHHHHHHHHHHHHHHHHHHLLLLLLL
PiMo iiiiiiiiiiiiTTTTTTTTTTTTTTTTTTTTTTooooTTTTTTTTTTTTTTTTTTiiii
iiiiTTTTTTTTTTTTTTTTTTooooooo

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[XWDyRaX-qNrGhrJUuT9YZQAAAAE] 2019-08-24 08:16:07: Fatal exception of type "TypeError"

Navigation menu