ENST00000305709.5

From LncRNAWiki
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000305709.5

Source

Gencode19

Same with

NONHSAT131550

Classification

intergenic

Length

2541 nt

Genomic location

chr9+:66553273..66555928

Exon number

2

Exons

66553273..66553558,66553674..66555928

Genome context

Sequence
000001 GGCACTGACT GGGTCACTGG TGAAGTTCCC CGCAGGAACT GAGTCAGACC CCATCTCAGG GCCCTGCACA AGATAGGTAC 000080
000081 CTGCTCTAAG GCGTGGACCC TCGCCACAGC CCTGGCCCGT CTTGACGGGC GAGGGTTACT GTACTTGTCC CAACCGTACA 000160
000161 GATGAGAAAG CTGAGACTCA GGGCCAGCAA CCCGGGTCCC AGCGGAGCGC CCGGCACGCG CCAACACTTC AGCACCAGTC 000240
000241 GCGGTGGCCA CCACTGTGCG CGGAGATGGC TGCGACGCGT GCGCAGATCT CGATCCCAAA CTCCCTCCTA CCAGAATCTG 000320
000321 GACCCGAATC CACCCATTGT CCGTTTTCCG CTGCCGCTGG AGAGAATCTC TGAGGTCCCC AGGAGAGCCT GCCTGCACGG 000400
000401 AAGAGACGCC TCCTCGGTAT GGCCGCCCCC GGAGAGGAGC GATTAAGTGC AGACCTCCAT GTTGCTCTTG AGCCTGAGCG 000480
000481 GCTTCAGGGA GCCATGTTTG TTACTGGCGG GCGCCGACCT CACTGAGCAT GTGCAGCCCT GGCCGGGCGG CCTCAAAGTT 000560
000561 CTGACATCAC AGGGCGGTTC CTGAAGTGGA CATAGTTGTA AGAGCTAGTT ATTTTAGACA ATGCCTCTGT GATCAGGGAC 000640
000641 TCTAATCTGG AAATAGGTAG TCGGAGAGGT CGGTGATGCA GTCTCTGGAT CAGAGACCTG AGCTATATGG GGTTAGAGAG 000720
000721 GGGCCCTGGG CAGGCGAGTC TCTGGGGAGT GTGGTGAGAA TCCTTGTGTA AGATGCTGGG AGGAGGTGGG GTCAGGGCTG 000800
000801 GGGTCCGTGG GCCGACGGGT TGGGGGATGG CCAGCGTCAG GGATCAGTAG TAGAGATTCT ATGTGCCCTG ATCGCCAGTG 000880
000881 GAGGTTTTAA ATACAGAGTA TTCATGAGTT TAGCAATGTT ATTCGCCTCT CATTATTTAA ATAATTTGAA GTTTTCCCCA 000960
000961 ATAACTAGTG TCTTAGAAGT CATGAAAATT TCAGAAAATG ACAGGTCTTC TGAGTTCATG ATGGGAGTTG GGCAGCAGTC 001040
001041 GCATACGAGC ACCTGGAGAG TCCTTGCCAG TTCTTTGGGG ATGGGGAGCT CTTAAGACTG CCCTGAGACC GCCCTTTGAC 001120
001121 CTCATTGTGG TCCTTTCTAG ATTAAATGCT GTTTTCCATG ACCGTCTCTG TTCTTCCCAT ACGCGAATGG CAGGCATTCA 001200
001201 GATCTCCAAG AATAGAGGAT TAGGAGAGAC TCCACCACCT ATGTCCTCAC AGTTAATTAT CGATTTGTGT CAGTTGCCCA 001280
001281 TTTTCTCACT TCCTGTTTGT GTGTCAAGGG GTATTAATAA ATCTTTGCCT ATTTAAAGAT ATTAGCCTTG GATTTTCAAA 001360
001361 TATTGCATAT TTTGACATGT AAAAATTTGT TAGTTTTATT TTTTCAACCG ATCTGACCTG TATAGTTGGG CTTGAGGAAG 001440
001441 CTTCCTCATT CTACATGTTA CTATGGATTT TCTAATATTA ACACAGGGTT GTATTTTTTC CATATAACTT TCTATTGAAT 001520
001521 TTCTTTTTCC ATATGATAGG TGGTGAAGGT TTAGCCCAGT AAAGCAGAGA GGTTAAGAGG TTAGATTGGG GGCTCTGGAG 001600
001601 CCAGACCTGT GTAGATCTGA GTCCTGGCTC TGGCACTTGA AAGCCGTGTG ACCTTGGTTA AGATACTTAG TCCCTCTCTG 001680
001681 CCAAATGGAG AAATAAGGGC ACCTACCCCA TAGGGTAGTT GTGTGATTAC ACAAGTTAAT ACACTTCAAT CAGTAGCAAG 001760
001761 AAAGTGAATG TCAAGCTGTA TTTGTTCAGG CAGCCATATG GTAGCCCCAC GTCCTTAGTA AACTGAGGTA TTGAAGTATC 001840
001841 TTCTTTTTCT TTCAGAAAAT ATTTGTCAAG CACCTTCTGT GTTCAAAGAA CTGTTCTAGA GCTTTACATG CTATGGAGGT 001920
001921 CTAGAAATTC ACATTATGGT GGCAGGTGAC AGACAATACA AAGAGATAAA GCAATTTTAT ATAGTGATAA GCTAGGGAGG 002000
002001 AGTGCTAAAA GGAGCCAAGG TGTAGTGGTG ACTGGAAGGT GACCAGGGAA ACCACTGTAG GGTTTCTAAG TGATGAGATC 002080
002081 TGTGACAAAT CCCTGTGGTC AGCAGCAGGC ATTGGATATG TAACTTTATT CTGTCCCATT GATCTTGTAG TCAACCCTGG 002160
002161 TCTGTTCTGT ATTGTTTTAA TTACATAATC TTTGTAATAA TCTTTAATAC CTGGTGGAGT GCTCTGTTTA CTTATTTCTG 002240
002241 CGTAATTAAC CACCCCTAAG CTTAACTTAC TCATGGTTCT GCAGGGTGAC TGCTCTCCAT GGTTCTAGGT GGTTCTGCAT 002320
002321 GGGGCCTCTC ACATGTGCTA CAGTCAAACA TTAGCCGGGG CCACAGTCAT CTGAAACTCA CTTACATGGC TGACAATTGA 002400
002401 TGTTGGCTGT TGCCTGGAGA AGACATATGT GGCGTGGTGG AATGGAATGG TGACTAGATT CAAGAAAGAG CTTCCCAGGA 002480
002481 GGAAGGCTAC CAAGAGACCG AAGTAGAGGC TTCAGTTTCT TAAAAAAAAA AAAAAAAAAA A
[back to top]

Predicted Small Protein

Name ENST00000305709.5_smProtein_161:445
Length 95
Molecular weight 10769.1087
Aromaticity 0.0531914893617
Instability index 93.5244680851
Isoelectric point 11.9057006836
Runs 13
Runs residual 0.00948196114709
Runs probability 0.0318848260025
Amino acid sequence MRKLRLRASNPGPSGAPGTRQHFSTSRGGHHCARRWLRRVRRSRSQTPSYQNLDPNPPIV
RFPLPLERISEVPRRACLHGRDASSVWPPPERSD
Secondary structure LLEEEEELLLLLLLLLLLLLLEEELLLLLHHHHHHHHHHHHHHLLLLLLLLLLLLLLLEE
ELLLLHHHLLLLLLLLEELLLLLLLLLLLLLLLL
PRMN -
PiMo -

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[XWD9X0U93VdrpSlsj7EzFgAAAAY] 2019-08-24 09:03:29: Fatal exception of type "TypeError"

Navigation menu