ENST00000304233.3

From LncRNAWiki
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000304233.3

Source

Gencode19

Same with

lnc-BLK-1:1

Classification

intergenic

Length

2150 nt

Genomic location

chr8+:11433822..11438851

Exon number

3

Exons

11433822..11434826,11435879..11436150,11437979..11438851

Genome context

Sequence
000001 AAGCACCTCA AACCCAGTTG GCCCCAGTGC CAGGAACCGA GCACTATTGT CATGTAGACC AAGCACCTCG AACCCAGCCG 000080
000081 GCCCCAGTGT TAGGAACCGG GTACTGTCGT CATCAGCATC AGGGTCAACC TCTGGACCCT GGCTTCCTCA GCATTAACAG 000160
000161 GAAAGGTTAG AAGCCCTGTT AGGTCTCTTC CAACTTTGTC TATAACTCTG AAAAAGCAAC GTGGAGTTTC TCTGGCACAC 000240
000241 TCTTTGAGGA AATAGAATTC GCCAAACCAA TGCAAATGGA GAAATATATT TCACCTGAGT AGGGAAGAAA AACCTTGTAA 000320
000321 AGGCTTCCAA GAACCTCCAG AAACCTACTG GATGAGCTTA CCACTAATCT CTTTTAAAGC AATTCCCTGA CAACACTCTG 000400
000401 TTAATCTCTC CTGAGCTCCT TAGTACCCCC TGAAAGTAGC AGGACAGCCT TACTTTCCAA ATCTTCACCT TTGCAAGAGT 000480
000481 CTAGTCTGTG AGTCCAGGCT CACCTGAAGT CTGAGATTTT GGGAGCTTTG GAGAATTCTG GATAAAATCC CTTACTGGAC 000560
000561 TTAGCAGGAA TCTCCGATCT GTGGAGAAGT CTCCTCAGAG ACTGAGCATC TGTTCCTAGC TCCCTCCGGG CTCTGATGCC 000640
000641 ATTAATGACT GCAGGAAGCT GTTCCAGGCC TCAATACAGA AAGAACCCTT AGACCCTCAG AGCTGGAGGT GTGCAGACTG 000720
000721 GTCTCTGCCT GGGCTCAACC TCTGTGATTT CTGGCAAGTT ACTGAAATTC TCTGTGCCTC AGGTTTCTTT TATGAAAATT 000800
000801 ATAACAGTTT TATCTCCTAG GGTTATGGTG AATACCTAGG GCAGGACCGG GCACTTAGAA AGCTCTCATC CAATGTCCCC 000880
000881 TAACTCTTGG AGACAATAAT CAAGACTTAG AGGAACTGAC TGGGGGAAAC GTCAACACTT TCTTGGTTCT CTCAGAGGCC 000960
000961 GGTGGAGACG CTGCTCCATT CTGCCTGGAT CATTTCCCAG GGCAGTATGA GACAGGCCTT CATCAGAAAG GCCGGGCCTG 001040
001041 TGGATGGAGG CAGGGGGCTG ATGGAAATGA CCTCTGTGCA GCTAAGGATG CTATGCTTTG TTTCTTGAGC TGAACTGCAA 001120
001121 TTGTGCCCAG CCTTCCTGGG ACAAGGGTGG GAACTCAGGA GTTACTACAA CCACCGCCAC CCCACCCTGG GAAGGCCATT 001200
001201 TGTGGTCTTG GACAAGTTCC CTCCCACGTG GCTGGACGAG CCCTCAGGCG ACAGCTGCGT TCTGTCGAGG AAGCCACGCG 001280
001281 TAGGTAGGTG ATTCCCCTAC TTAATCTGGA TCAGACTCAC CCTGGACTAA TGCCCATGCT CCTGCCTCCA GGCCCATAGA 001360
001361 AGGAGGAGGC AACCCATCTG GATGTGTGGA GGAGGTTTTG ATCTCCTCTT CTTGGTCAGA ACTGCTCATA AGAATCTCCA 001440
001441 CTGCAGGATC GATATTTGCT GCCATTTCTT TTCCTCTGCA CACACATTCT AGAGTAAGCA GCAAACAGAG GTGACCAGAG 001520
001521 ATGCTAGGAT GGCAACATGA GGGGTCTGGA AAGTCTCCCA CTGAGCGATC AGAAGCTGGG TTTCACATAC TCACCACGGC 001600
001601 TAGTCTAGCG AGTTTGCAGA ATTCAGAAAC GGGATGAGAC CCTGAGGTTT GCCTTTCATT AGCCTGGCTG TCCACTTATG 001680
001681 GGACAGTCTC TGCAGGAAGG AAGGAAACAG GGGAGGCTCC TACCTGCCCC ATCAGCTCAC TTTTTAAAAC ATGCTCACCT 001760
001761 GGCCTCACCA AGTGAGGTGG GAGGAGAGCC CGAGATCGGT TCACTTTGTG CTTCACATGT CCTTCACATG TCACCTCTCT 001840
001841 ACTCCGTGAA CTTGCAAGTC TCACCTGGGT CTCTCACTTT CCATTCCCTG TCTCTCAGAT CTACTAGCAC AAGGCTACAG 001920
001921 CCACAAAGCA CTTATATAGT TGGGCCCCTT TGCTGACACG TGACATGCAA TTCAGGGATG CCTCCTCCTC CCCCTAGAAG 002000
002001 TGATGAGTGC CTGCAGCTAT TGTAAATGTT AAAGTAAAAT TAATGTTGGT TGTACACCCA TGTTCATAGC AGCATGACTC 002080
002081 ACAATAGCCA AATGTAGAAG CAATCTGTAT TAGTCCGTTC TCAAGCTGCT AATAAAGACA TATCTGAGAC
[back to top]

Predicted Small Protein

Name ENST00000304233.3_smProtein_1520:1636
Length 39
Molecular weight 4016.3214
Aromaticity 0.0526315789474
Instability index 72.0578947368
Isoelectric point 5.38604736328
Runs 6
Runs residual 0.014716066482
Runs probability 0.0366984631691
Amino acid sequence MLGWQHEGSGKSPTERSEAGFHILTTASLASLQNSETG
Secondary structure LLLLEELLLLLLLLLLLLLLEEEHHHHHHHHHHLLLLL
PRMN -
PiMo -

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[XS42kNwePzapxoz3eCj-8AAAAAI] 2019-07-16 20:41:54: Fatal exception of type "TypeError"

Navigation menu