ENST00000299997.4

From LncRNAWiki
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000299997.4

Source

Gencode19

Same with

NONHSAT068161

Classification

intergenic

Length

660 nt

Genomic location

chr19+:56989552..57006801

Exon number

3

Exons

56989552..56989645,57005532..57005711,57006416..57006801

Genome context

Sequence
000001 GACTGGGTGG ATGAGGCTCA CCCCGGCGGG GAGAAGGGAC GAGGAGGGGC GGACAGCGGA AGGTCCGGGA GTGTCCGCCA 000080
000081 TAAAGTCGTT TGAGTTTTAA CTTCTAGTCA TGGCGAATGA TCGCAGGAGA GCACAGACTG GACCCTGCTA CGATCTCTCT 000160
000161 TGGAGTGGAT CAGACTGATG ATCACCAACA ACCAACTCAT TCCCGGATAA GGAAGAAGAG AGTGTCACCT ACTTCAGTGT 000240
000241 GGTTTCAACC CTACTTCTGC ATCTTAAAGA CACTGTGTAC AACGTTGGAC ACTGTGCAGG ATGATGCCAC TTCATCTTGG 000320
000321 ATGCTAATCT GCCATGTTGA CTTCTGATTA ACCCCAGGCC CAGGAATGCC TCAAGATTTC TACTTTACTT ACTGTTGCTT 000400
000401 GTGTAAGCCA AGACAACCTT GATGTTATCA TAAACATGTA CTTACCTAAG TCCTGTCCTT TGGCAAATTA TGGGCTATGA 000480
000481 GACACAGCAT TCTTGCCTTT CCCTGAGGGG TCAATTTCAG CGATCCTACA CATTCCTTCT GAAGCACTTA TGCTCTTTCT 000560
000561 ATATGGTATG TAAGCTCTCG GTCTGGGGAG TAACAGTGCA GAGATCTACC TGTCTTGTTG CCACATGTTT CTAAACTTTC 000640
000641 CAATAAATCA CCTTCTACTG
[back to top]

Predicted Small Protein

Name ENST00000299997.4_smProtein_116:346
Length 77
Molecular weight 8703.8111
Aromaticity 0.0789473684211
Instability index 41.8815789474
Isoelectric point 5.99261474609
Runs 14
Runs residual 0.0428009679371
Runs probability 0.0421429833195
Amino acid sequence MIAGEHRLDPATISLGVDQTDDHQQPTHSRIRKKRVSPTSVWFQPYFCILKTLCTTLDTV
QDDATSSWMLICHVDF
Secondary structure LLLLEELLLLLEEEELLLLLLLLLLLLLLLEEEEELLLLEEEELLLEEEEEHHHLLLLLL
LLLLLLLEEEEEEEEL
PRMN -
PiMo -

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[XWEDNh7zfgbxLLvWP3dTawAAAAM] 2019-08-24 09:28:24: Fatal exception of type "TypeError"

Navigation menu