ENST00000295549.4

From LncRNAWiki
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Transcriptomic Nomeclature

Please input transcriptomic nomeclature information here.

Function

Please input function information here.

Regulation

Please input regulation information here.

Expression

Please input expression information here.

Allelic Information and Variation

Please input allelic information and variation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this lncRNA

Please input related labs here.

References

Please input cited references here.

Basic Information

Transcript ID

ENST00000295549.4

Source

Gencode19

Same with

,

Classification

intergenic

Length

1407 nt

Genomic location

chr2-:177494317..177502659

Exon number

3

Exons

177494317..177495160,177497761..177497853,177502190..177502659

Genome context

Sequence
000001 GCGAGCCACG GGCCTCGCTG CGGGTTCAAG TGCGTCCGGG TTTGGACGTC GCGGCTCCAG GAGTGTGCTC TCTCTCCTGC 000080
000081 CCATCCCCTC CCCGGAGTTC AGCGCATCCG GGGCCCCGGG GACCCCTCTT CCCGGCCCTC CTGGCCGCGC TGGCCCGCCC 000160
000161 GCATGGGGCC GAGGTTCCTG GCCGACGCGC GAGGGCGCGG GCGGGTACCG GGTTCCCGTT TTTCCCAGGC CCCGATCCCC 000240
000241 GCCCACGCAC GAGGCCCCCG GCCCACGCAC GAGGCGCCCA CGCCCATCGT GGAGGCTCCG CCTGGAAAAG AAGTCCGACT 000320
000321 TCCTCTCCAA GCTGCTCCGA GGGGAATGGG GAATCGGCAG GAAATGACCC GAACTGCCAG CCTGCGCCTT TGCAGCCGGC 000400
000401 CCTCGCTTTG CTGAAGACGA GCAGCTCCCA CCAAAGTCTT GCCTCCCCTT ACCCCGAAAG CCCCGCTCAG TTCAATATTT 000480
000481 CAAGTGAAAA TCTGCCTGTT CGAAAATAAA ATATTCACAA ATGAGCAGTG TATTAGAAGA CAACTGAATT GCTTCTAAGA 000560
000561 ATGGGTCTCA CTCTGCCATC ACCCAGGCTG GAGTGTGGTG GCACCATCAT GGCTCACTGC AGCCTTGAAC TCCTGAGCTC 000640
000641 AAGTCATCCT CCCACCTCAG CCTTCCGAGT AGCTGGAACT GCAGGTGTGA GCCACCATGC CTGGCTGATT TGTCTTTTTA 000720
000721 AATTTTTTAT AGAGACCGAG TCTCAACTAT ATTGTCCAGG CTGGAAAAGA ACTTCTTTCC CTCCAAGTGA TAACCTTTTC 000800
000801 CAGACAAGTC AGCTTAAAAA CTGACCCAAA GGCCCTGAAG TACACAGTTT TCTTGGAGAA AGAAAAAAAT AAGTGAAAAG 000880
000881 GACTTGCTGA CTTGCTAATT CATTTTGGGG CCTGTGGGTA ACATCAGAAT GGCAAAGCAC TTGGGGCTTT TTTCTAATTT 000960
000961 GTATTTTTTT AATCTTCTGA GAAATGACTT TTATATGCCA AGATTCATTC CATGATTAGT TTTTATGACC AAGTTATGAA 001040
001041 CGCTTTTGAA TATGGGGACC TAGAATAGAA ATGCTAACCT ACCTGCAAGG AGAGCTCTGT GATTGGCATC CCCATCATGC 001120
001121 TGTAACTGAC ACAAAATAAA CTTAGGGTAA TTGCCGCATA GTGTAACTTT AATGTGTGAG CATACTGTAA CATCTGACAA 001200
001201 GCTTCTTGAT CTAGATCAGC AATGTGTAAC CCATTCATTG TTGTCACTCT CAACAAGGCC TTATGGTCAA ACATCATCAC 001280
001281 TCTCACTAAA GAGATAGTTT ACTGAAATAT ACTGAGATTT TGAAACTGGA GTCAAGAGGT AGCACACTGT TTTATGTTGA 001360
001361 TCCATTTAAT GGTCCTTGAC AGCCAATAAA AAGACACTGG AAGAATA
[back to top]

Predicted Small Protein

Name ENST00000295549.4_smProtein_560:823
Length 88
Molecular weight 9582.9318
Aromaticity 0.103448275862
Instability index 58.6218390805
Isoelectric point 7.73394775391
Runs 12
Runs residual 0.000328407224959
Runs probability 0.0363010068892
Amino acid sequence MGLTLPSPRLECGGTIMAHCSLELLSSSHPPTSAFRVAGTAGVSHHAWLICLFKFFIETE
SQLYCPGWKRTSFPPSDNLFQTSQLKN
Secondary structure LLLLLLLLLLLLLLEEEEEEEEHHHLLLLLLLLLEEELLLLLHHHHHHHHHHHHHHHHLL
LLEELLLLEELLLLLLLLLLLLLLLLL
PRMN LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHHLL
LLLLLLLLLLLLLLLLLLLLLLLLLLL
PiMo ooooooooooooooooooooooooooooooooooooooooTTTTTTTTTTTTTTTTTTii
iiiiiiiiiiiiiiiiiiiiiiiiiii

Navigation menu

Internal error - LncRNAWiki

Internal error

Jump to: navigation, search
[XS47LgAosPnTKR5wmgu5MQAAACg] 2019-07-16 21:01:36: Fatal exception of type "TypeError"

Navigation menu